Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027635 (Dsn1)
Chromosomal location
Chr 2: 156821001 - 156832890 (-)
Description
DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) Gene [Source:MGI (curated);Acc:Dsn1-002]
RefSeq_dna
NM_025853 
RefSeq_peptide
NP_080129.1 
UniGene
Mm.394343 
MGI
MGI:1914184 
Uniprot/SWISSPROT
Q9CYC5 
Uniprot/SPTREMBL
A2ACV5 B0QZT4 B0QZT5 A2ACV4 
Human Ortholog
ENSG00000149636 (C20orf172)
Omim not available
UniTrap UNI20021
Vector Insertion
Chr 2: 156831583 - 156831610
Public Clones not available
Private Clones OST374878 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33941
Vector Insertion
Chr 2: 156831583 - 156832812
Public Clones (ggtc) IST10947B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15738
Vector Insertion
Chr 2: 156821000 - 156822557
Public Clones PST118-1 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029163
Sequence
AGTTGTTCGGCGGGAGTTTCGTAAGTAGCGGAGGCAGCGGGGAACCCCGAACCGGACTGACGCGGGAGAGGACCTTCTGCGGCGACGCCGAGTTTGCAGA

G - UNI20021 - - UNI33941 - GATGACGTCAGTGACCAGATCAGAAG - UNI20021 - - UNI33941 - ACCAGGAACCCACGATGTC

CGAGACTCAGGATCGTCCATTGCAGCCAAGTCTCAAGCCTTTGGAAGCATTGCCTCAATCCTCTGCCTACCAGGAAATGATGACGCAAGGCGTTTCAGAG

GAAAAAAACCACCTTGGCTCGAACCCTGGAGAGGGGGAAAGTTGTGGTGCCGACCACCAGGAGGGATCTCAGTTGAGGTCCTTTCATTTGTCCCCTCAAG

AACAGTCTATCCGTCCTCAAGACAGAAGGCAGTCCTGGAGACGAGCAAGCATGAAAGAAGTAAACCGGCGGAAGTCATTGGCTCCCTTCCACCCAGGCAT

CACAG AGCTCTGCAGGTCCATCAGTGTGAAGTTAGCCCAGAGCCAACGGCTGGGCGCCCTCCTGCTCTCCAGCTTCCAG TTCTCTGTTGAAAAACTTG

AACCTTTCTTAAAGAACACTAAGGACTTCAGCCTTGAATGTTTTAGAGCGAAAG CATCTTCTCTCTCTGAAGAATTGAAACATTTTACAGACAGGCTGG

GAAATGATGGAACACTGCAAAAATGTTTTGTTGAAGATTCAAAAGA GTTTTCTTTAGAGCGTCAGGCCTGGGATCGGCTCTTACTGCAGTACCAGAACG

AGGTTCCACCTGAAGAGATGCCCAG AGGATCAACTGAAACCAGAATCACTGAAGTCAAGGTGGATCCTGCAGCCTACCTCAGGTCTTCCCAGAAGGAAG

TTCTTAGCACGAAGCCAGACTACCAGAGAATAGTACAAGATCAGAACCAAGTCTTTGCCTACGTGGAGTTAGTG - UNI15738 - ATGGATGAGCTC

CAAGGATCAGTGAAGCAGCTGCAAGCCCTCATGGATGAGAGTACTCAGTACCTCCAGAAGGTGTCAGTACAGCTCA - UNI15738 - AGAAGAGAAG

TATGGACCAATTAGACTCTTCACCTGCTCGGAAACTGCTCAAGCTCCCCCTCCAGAGCTCACCTTCCACGCAGTGATGAGGATCCTGTCAGGGACCCTAC

CTCACAGCAGTCAGCTGGAATGTCCCAGCTCTACAGCACTTCACTGTTGCCGAGTGACAGCATGTATGTATCCAGAAGAGTGTGTTAAGGACACTTTTTG

TCGGGATGTGCACGATGCTCAAAATGGCCTTCAGAACCAGTCGTCCGTTGCTCCTAACATCCTCATGGTCAGCGCTTTTCATCCCATAAAATAATCCAGA

GACATCTAAAACCAACCTCAAGGAAATGTTTTAGAGGCCAAGGTGGGTTGTTGCCATAAAAGACTGACGCTAAAGTTTGTGAGTGTGGGACTGAAGGTGG

ATTATAGGATGTTGTCACATAACGGGTATGTGTGGACACTTTACAGCATGCCCATTTTCTGAAGTGTCCTAATCTCTGTAGAGTGCTTTAGTTTTTAATA

TTGAATTGACTTCCTGGAATCTAAATTCATGACAAGAAAAGGCTGTGCCAATTTAATTTTTTCCTTTGGGAATTACCCCTGCCTCCCTAAGAATTGACCC

CAGAGCTTTGTGGGTGCTAGGGAAGCACCCTCAAGAAGCTGCACCTTTAGTCCCCATATTTTGGGGTTTTTAATATTTTTTTTAAGTTCTGTTAGTGAAT

GGCGTGTTATTTAAAAACCGTGTGTTGTCATTTCCTGGGGCTGAGATAGAGTTATTTAACCTCTTATCTCGAACATTAGATGGATGTTAGAATCTATGTC

GTAAGGACACTGTGAGGATTTGTTTAAAGAGTAAAAGCCTAGAACAATGTTATAGTTTGTTGTTGAAGACTTAATAAAATGAGTATACTGTAGTTAATGA

GGTGGGAAAGCTACTATCTCATATGGAATACCACATGGAGAACTCAAGCAGATACATAAAGTCTGGATTAGAAATAAACTTACAAGTTTTGCCTAGTTGT

TGAAGTG
Translation
 - UNI20021 - - UNI33941 - MTSVTRSED - UNI20021 - - UNI33941 - DQEPTMSETQDRPLQPSLKPLEALPQSSAYQEMMTQG

VSEEKNHLGSNPGEGESCGADHQEGSQLRSFHLSPQEQSIRPQDRRQSWRRASMKEVNRRKSLAPFHPGITE ELCRSISVKLAQSQRLGALLLSSFQ F

SVEKLEPFLKNTKDFSLECFRAKA ASSLSEELKHFTDRLGNDGTLQKCFVEDSKE EFSLERQAWDRLLLQYQNEVPPEEMPR RGSTETRITEVKVDP

AAYLRSSQKEVLSTKPDYQRIVQDQNQVFAYVELV - UNI15738 - MDELQGSVKQLQALMDESTQYLQKVSVQLK - UNI15738 - KKRSMDQ

LDSSPARKLLKLPLQSSPSTQ
Transcript ENSMUST00000103129
Sequence
AGTTGTTCGGCGGGAGTTTCGTAAGTAGCGGAGGCAGCGGGGAACCCCGAACCGGACTGACGCGGGAGAGGACCTTCTGCGGCGACGCCGAGTTTGCAGA

G - UNI20021 - - UNI33941 - GATGACGTCAGTGACCAGATCAGAAG - UNI20021 - - UNI33941 - ACCAGGAACCCACGATGTC

CGAGACTCAGGATCGTCCATTGCAGCCAAGTCTCAAGCCTTTGGAAGCATTGCCTCAATCCTCTGCCTACCAGGAAATGATGACGCAAGGCGTTTCAGAG

GAAAAAAACCACCTTGGCTCGAACCCTGGAGAGGGGGAAAGTTGTGGTGCCGACCACCAGGAGGGATCTCAGTTGAGGTCCTTTCATTTGTCCCCTCAAG

AACAGTCTATCCGTCCTCAAGACAGAAGGCAGTCCTGGAGACGAGCAAGCATGAAAGAAGTAAACCGGCGGAAGTCATTGGCTCCCTTCCACCCAGGCAT

CACAG AGCTCTGCAGGTCCATCAGTGTGAAGTTAGCCCAGAGCCAACGGCTGGGCGCCCTCCTGCTCTCCAGCTTCCAG TTCTCTGTTGAAAAACTTG

AACCTTTCTTAAAGAACACTAAGGACTTCAGCCTTGAATGTTTTAGAGCGAAAG CATCTTCTCTCTCTGAAGAATTGAAACATTTTACAGACAGGCTGG

GAAATGATGGAACACTGCAAAAATGTTTTGTTGAAGATTCAAAAGA AAAAGCAGCAGATTTTTCACTGGAAGCATCAGTAGCTGAGGTGAAAGAATATA

TAACAAA GTTTTCTTTAGAGCGTCAGGCCTGGGATCGGCTCTTACTGCAGTACCAGAACGAGGTTCCACCTGAAGAGATGCCCAG AGGATCAACTGAA

ACCAGAATCACTGAAGTCAAGGTGGATCCTGCAGCCTACCTCAGGTCTTCCCAGAAGGAAGTTCTTAGCACGAAGCCAGACTACCAGAGAATAGTACAAG

ATCAGAACCAAGTCTTTGCCTACGTGGAGTTAGTG - UNI15738 - ATGGATGAGCTCCAAGGATCAGTGAAGCAGCTGCAAGCCCTCATGGATGAG

AGTACTCAGTACCTCCAGAAGGTGTCAGTACAGCTCA - UNI15738 - AGAAGAGAAGTATGGACCAATTAGACTCTTCACCTGCTCGGAAACTGCT

CAAGCTCCCCCTCCAGAGCTCACCTTCCACGCAGTGATGAGGATCCTGTCAGGGACCCTACCTCACAGCAGTCAGCTGGAATGTCCCAGCTCTACAGCAC

TTCACTGTTGCCGAGTGACAGCATGTATGTATCCAGAAGAGTGTGTTAAGGACACTTTTTGTCGGGATGTGCACGATGCTCAAAATGGCCTTCAGAACCA

GTCGTCCGTTGCTCCTAACATCCTCATGGTCAGCGCTTTTCATCCCATAAAATAATCCAGAGACATCTAAAACCAACCTCAAGGAAATGTTTTAGAGGCC

AAGGTGGGTTGTTGCCATAAAAGACTGACGCTAAAGTTTGTGAGTGTGGGACTGAAGGTGGATTATAGGATGTTGTCACATAACGGGTATGTGTGGACAC

TTTACAGCATGCCCATTTTCTGAAGTGTCCTAATCTCTGTAGAGTGCTTTAGTTTTTAATATTGAATTGACTTCCTGGAATCTAAATTCATGACAAGAAA

AGGCTGTGCCAATTTAATTTTTTCCTTTGGGAATTACCCCTGCCTCCCTAAGAATTGACCCCAGAGCTTTGTGGGTGCTAGGGAAGCACCCTCAAGAAGC

TGCACCTTTAGTCCCCATATTTTGGGGTTTTTAATATTTTTTTTAAGTTCTGTTAGTGAATGGCGTGTTATTTAAAAACCGTGTGTTGTCATTTCCTGGG

GCTGAGATAGAGTTATTTAACCTCTTATCTCGAACATTAGATGGATGTTAGAATCTATGTCGTAAGGACACTGTGAGGATTTGTTTAAAGAGTAAAAGCC

TAGAACAATGTTATAGTTTGTTGTTGAAGACTTAATAAAATGAGTATACTGTAGTTAATGAGGTGGGAAAGCTACTATCTCATATGGAATACCACATGGA

GAACTCAAGCAGATACATAAAGTCTGGATTAGAAATAAACTTACAAGTTTTGCCTAGTTGTTGAAGTG
Translation
 - UNI20021 - - UNI33941 - MTSVTRSED - UNI20021 - - UNI33941 - DQEPTMSETQDRPLQPSLKPLEALPQSSAYQEMMTQG

VSEEKNHLGSNPGEGESCGADHQEGSQLRSFHLSPQEQSIRPQDRRQSWRRASMKEVNRRKSLAPFHPGITE ELCRSISVKLAQSQRLGALLLSSFQ F

SVEKLEPFLKNTKDFSLECFRAKA ASSLSEELKHFTDRLGNDGTLQKCFVEDSKE EKAADFSLEASVAEVKEYITK KFSLERQAWDRLLLQYQNEVP

PEEMPR RGSTETRITEVKVDPAAYLRSSQKEVLSTKPDYQRIVQDQNQVFAYVELV - UNI15738 - MDELQGSVKQLQALMDESTQYLQKVSVQL

K - UNI15738 - KKRSMDQLDSSPARKLLKLPLQSSPSTQ
Transcript ENSMUST00000103130
Sequence
AAATCCCGGAGTACGCAGGCGCTCCGCCGGAGGCACGGGTTGCGCGAGCCAGCGCGGAAGGCGGAGGCTGCGCACGCGCAGTTGTTCGGCGGGAGTTTCG

TAAGTAGCGGAGGCAGCGGGGAACCCCGAACCGGACTGACGCGGGAGAGGACCTTCTGCGGCGACGCCGAGTTTGCAGAG - UNI33941 - GTGCTG

GAAATGGGGATGTGGTGCGATCTCCAACCAGTTCTATAGAGGAAAGATGTGTGGCCTCCAAATCTGCCAAAGAGAAGTGACTGCGTATTTAAGCAGAGTT

AGGGAGGAGGATGACTCTGTTTTATGGGTAGAAGGACAGATGTGGGCAGAGATTAAAAAGTAGGATTTCCAGCCATGGCAAAATCTGGAGAGAGTAAGAA

GTGATGCGGGGTTTGTTTGTTTGTTTTCTCGTTTGGAAAACAAAGATCCTAAGACCTTCCACGGAACTGGGGGCTAGTGCCTCACAAAGTGAGGAGCTAA

GATAGGTTCTGTAGACCGAGTTCTTGAAGACAGCAGTCAGTGATAGTAATCTTGCTGCTGAGAATCTCGGAGGAGGCAAGTGAGGGCACCTGAAGCATGA

GACCTATTATGGGATAGTGAGGCCCCTGTGAGACTGGAGCTCGAACGGATCTCCTCATTTTCCTGTTTTCCTCCTTCATCCAGGATGACGTCAGTGACCA

GATCAGAAG - UNI20021 - - UNI33941 - ACCAGGAACCCACGATGTCCGAGACTCAGGATCGTCCATTGCAGCCAAGTCTCAAGCCTTTGGA

AGCATTGCCTCAATCCTCTGCCTACCAGGAAATGATGACGCAAGGCGTTTCAGAGGAAAAAAACCACCTTGGCTCGAACCCTGGAGAGGGGGAAAGTTGT

GGTGCCGACCACCAGGAGGGATCTCAGTTGAGGTCCTTTCATTTGTCCCCTCAAGAACAGTCTATCCGTCCTCAAGACAGAAGGCAGTCCTGGAGACGAG

CAAGCATGAAAGAAGTAAACCGGCGGAAGTCATTGGCTCCCTTCCACCCAGGCATCACAG AGCTCTGCAGGTCCATCAGTGTGAAGTTAGCCCAGAGCC

AACGGCTGGGCGCCCTCCTGCTCTCCAGCTTCCAG TTCTCTGTTGAAAAACTTGAACCTTTCTTAAAGAACACTAAGGACTTCAGCCTTGAATGTTTTA

GAGCGAAAG CATCTTCTCTCTCTGAAGAATTGAAACATTTTACAGACAGGCTGGGAAATGATGGAACACTGCAAAAATGTTTTGTTGAAGATTCAAAAG

A AAAAGCAGCAGATTTTTCACTGGAAGCATCAGTAGCTGAGGTGAAAGAATATATAACAAA GTTTTCTTTAGAGCGTCAGGCCTGGGATCGGCTCTTA

CTGCAGTACCAGAACGAGGTTCCACCTGAAGAGATGCCCAG AGGATCAACTGAAACCAGAATCACTGAAGTCAAGGTGGATCCTGCAGCCTACCTCAGG

TCTTCCCAGAAGGAAGTTCTTAGCACGAAGCCAGACTACCAGAGAATAGTACAAGATCAGAACCAAGTCTTTGCCTACGTGGAGTTAGTG - UNI1573

8 - ATGGATGAGCTCCAAGGATCAGTGAAGCAGCTGCAAGCCCTCATGGATGAGAGTACTCAGTACCTCCAGAAGGTGTCAGTACAGCTCA - UNI15

738 - AGAAGAGAAGTATGGACCAATTAGACTCTTCACCTGCTCGGAAACTGCTCAAGCTCCCCCTCCAGAGCTCACCTTCCACGCAGTGATGAGGATC

CTGTCAGGGACCCTACCTCACAGCAGTCAGCTGGAATGTCCCAGCTCTACAGCACTTCACTGTTGCCGAGTGACAGCATGTATGTATCCAGAAGAGTGTG

TTAAGGACACTTTTTGTCGGGATGTGCACGATGCTCAAAATGGCCTTCAGAACCAGTCGTCCGTTGCTCCTAACATCCTCATGGTCAGCGCTTTTCATCC

CATAAAATAATCCAGAGACATCTAAAACCAACCTCAAGGAAATGTTTTAGAGGCCAAGGTGGGTTGTTGCCATAAAAGACTGACGCTAAAGTTTGTGAGT

GTGGGACTGAAGGTGGATTATAGGATGTTGTCACATAACGGGTATGTGTGGACACTTTACAGCATGCCCATTTTCTGAAGTGTCCTAATCTCTGTAGAGT

GCTTTAGTTTTTAATATTGAATTGACTTCCTGGAATCTAAATTCATGACAAGAAAAGGCTGTGCCAATTTAATTTTTTCCTTTGGGAATTACCCCTGCCT

CCCTAAGAATTGACCCCAGAGCTTTGTGGGTGCTAGGGAAGCACCCTCAAGAAGCTGCACCTTTAGTCCCCATATTTTGGGGTTTTTAATATTTTTTTTA

AGTTCTGTTAGTGAATGGCGTGTTATTTAAAAACCGTGTGTTGTCATTTCCTGGGGCTGAGATAGAGTTATTTAACCTCTTATCTCGAACATTAGATGGA

TGTTAGAATCTATGTCGTAAGGACACTGTGAGGATTTGTTTAAAGAGTAAAAGCCTAGAACAATGTTATAGTTTGTTGTTGAAGACTTAATAAAATGAGT

ATACTGTAGTTAATGAGGTGGGAAAGCTACTATCTCATATGGAATACCACATGGAGAACTCAAGCAGATACATAAAGTCTGGATTAGAAATAAACTTACA

AGTTTTGCCTA
Translation
 - UNI33941 - MTSVTRSED - UNI20021 - - UNI33941 - DQEPTMSETQDRPLQPSLKPLEALPQSSAYQEMMTQGVSEEKNHLGSNPG

EGESCGADHQEGSQLRSFHLSPQEQSIRPQDRRQSWRRASMKEVNRRKSLAPFHPGITE ELCRSISVKLAQSQRLGALLLSSFQ FSVEKLEPFLKNTK

DFSLECFRAKA ASSLSEELKHFTDRLGNDGTLQKCFVEDSKE EKAADFSLEASVAEVKEYITK KFSLERQAWDRLLLQYQNEVPPEEMPR RGSTET

RITEVKVDPAAYLRSSQKEVLSTKPDYQRIVQDQNQVFAYVELV - UNI15738 - MDELQGSVKQLQALMDESTQYLQKVSVQLK - UNI15738 

- KKRSMDQLDSSPARKLLKLPLQSSPSTQ

For any suggestions or comments, please send an email to unitrap@crg.es