Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027643 (Ghrh)
Chromosomal location
Chr 2: 157155233 - 157172391 (-)
Description
growth hormone releasing hormone Gene [Source:MGI (curated);Acc:Ghrh-001]
RefSeq_dna
NM_010285 
RefSeq_peptide
NP_034415.1 
UniGene
Mm.389327 
MGI
MGI:95709 
Uniprot/SWISSPROT
P16043 
Uniprot/SPTREMBL
Q544X5 
Human Ortholog
ENSG00000118702 (GHRH)
Omim not available
UniTrap UNI34310
Vector Insertion
Chr 2: 157163091 - 157172392
Public Clones IST12905B3 (tigm) IST12881A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25921
Vector Insertion
Chr 2: 157159216 - 157159428
Public Clones not available
Private Clones OST151105 (lexicon) OST150050 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34839
Vector Insertion
Chr 2: 157157514 - 157159216
Public Clones (cmhd) IST14717A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28521
Vector Insertion
Chr 2: 157155372 - 157157514
Public Clones not available
Private Clones OST28958 (lexicon) OST28030 (lexicon) OST7636 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029172
Sequence
ACTGGTGATCCAGGCCGGCTCTCCAGGTCGCAGGTCTCTCCTGGTTGCGGCTCCCTGCTCATCTGGCTCCCACAACATCACAGA - UNI34310 - GT

CCCACCCAGGAGTGAAGGATGCTGCTCTGGGTGCTCTTTGTGATCCTCATCCTCACCAGTGGCTCCCACTGCTCACTGCCCCCCTCACCTCCCTTCAG -

 UNI25921 - - UNI34839 - GATGCAGCGACACGTAGATGCCATCTTCACCACCAACTACAGGAAACTCCTGAGCCAGCTGTATGCCCGGAAAGT

GATCCAGGACATCATGAACAAGCAAGG - UNI34839 - GGAGAGGATCCAGGAACAAAGGGCCAGGCTCAGCCGCCAGGAAGACAGCATGTGGACAG

AGGACAAGCAGATGACCCTGGAGAGCATCTTG - UNI28521 - - UNI34839 - CAGGGATTCCCAAGGATGAAGCCTTCAGCGGACGCTTGAGC

CCCCCGAGCCCCAAACACAACTGTACCCTGTTACTTCTGCTTCAGCTCTGACCTTTTCCGTCCTCTGTAAATACAATAAAACCCCCATTCTCATCTGC
Translation
 - UNI34310 - MLLWVLFVILILTSGSHCSLPPSPPFR - UNI25921 - - UNI34839 - RMQRHVDAIFTTNYRKLLSQLYARKVIQDIMN

KQG - UNI34839 - GERIQEQRARLSRQEDSMWTEDKQMTLESIL - UNI28521 - - UNI34839 - QGFPRMKPSADA
Transcript ENSMUST00000109536
Sequence
AGATGCCCAGTCTGCGGTCAGTGGGACCTGAGCAGAACCTCAATCGGAGAGAGATACCTGTCACCTCGGAG - UNI34310 - GTCCCACCCAGGAGT

GAAGGATGCTGCTCTGGGTGCTCTTTGTGATCCTCATCCTCACCAGTGGCTCCCACTGCTCACTGCCCCCCTCACCTCCCTTCAG - UNI25921 - -

 UNI34839 - GATGCAGCGACACGTAGATGCCATCTTCACCACCAACTACAGGAAACTCCTGAGCCAGCTGTATGCCCGGAAAGTGATCCAGGACATC

ATGAACAAGCAAGG - UNI34839 - GGAGAGGATCCAGGAACAAAGGGCCAGGCTCAGCCGCCAGGAAGACAGCATGTGGACAGAGGACAAGCAGAT

GACCCTGGAGAGCATCTTG - UNI28521 - - UNI34839 - CAGGGATTCCCAAGGATGAAGCCTTCAGCGGACGCTTGAGCCCCCCGAGCCCCA

AACACAACTGTACCCTGTTACTTCTGCTTCAGCTCTGACCTTTTCCGTCCTCTGTAAATACAATAAAACCCCCATTCTCATCTGC
Translation
 - UNI34310 - MLLWVLFVILILTSGSHCSLPPSPPFR - UNI25921 - - UNI34839 - RMQRHVDAIFTTNYRKLLSQLYARKVIQDIMN

KQG - UNI34839 - GERIQEQRARLSRQEDSMWTEDKQMTLESIL - UNI28521 - - UNI34839 - QGFPRMKPSADA

For any suggestions or comments, please send an email to unitrap@crg.es