Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027651 (Rprd1b)
Chromosomal location
Chr 2: 157854231 - 157956894 (+)
Description
regulation of nuclear pre-mRNA domain containing 1B Gene [Source:MGI Symbol;Acc:MGI:1917720]
RefSeq_dna
NM_027434 
RefSeq_peptide
NP_081710.1 
UniGene
Mm.403441 Mm.411122 Mm.475337 Mm.290810 
MGI
MGI:1917720 
Uniprot/SWISSPROT
Q9CSU0 
Uniprot/SPTREMBL
A2ACF7 
Human Ortholog
ENSG00000101413 (RPRD1B)
Omim not available
UniTrap UNI10097
Vector Insertion
Chr 2: 157854230 - 157854782
Public Clones XC299 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3524
Vector Insertion
Chr 2: 157861731 - 157861862
Public Clones BC0730 (sanger)
Private Clones OST430466 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19620
Vector Insertion
Chr 2: 157869141 - 157869276
Public Clones not available
Private Clones OST385988 (lexicon) OST29578 (lexicon)
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38028
Vector Insertion
Chr 2: 157869276 - 157873654
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12519
Vector Insertion
Chr 2: 157873654 - 157873765
Public Clones W083D02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12239
Vector Insertion
Chr 2: 157875950 - 157884387
Public Clones A047F07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21367
Vector Insertion
Chr 2: 157900665 - 157903932
Public Clones not available
Private Clones OST333040 (lexicon) OST36708 (lexicon) OST12357 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32140
Vector Insertion
Chr 2: 157903944 - 157956874
Public Clones IST12866H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109519
Sequence
GGTTAAAGCGCATTTTCGGTGTTCGAGGACCTGGATTTGTTCCCTCGGCCTGGCCGGCTAGAAGTCAGGGACCAAGGATACTGCCGCCTCCTAAGGATCG

TTTTCCTCCGGCTCCGAAGCCTCTCGGCGCCCGGCTGTGGCCCTTGCCCTTTGACCCCCGTGGCGGCGGGGTGAGAGGTCGGGTGGCCATCTTGTGGCGG

CGGCGCGGGCGGCTGTTACTGCGGAGACCTGTCCCCTCCCCCCACCTGGTACCCCGAGCTGTCTGTCAGTCGGCGGAGAGCCCTGCAGCCTGTCAGCGGA

GGCCTGGGCCGAGTGCGGTCGCTTTCCCCGTCTCATCGGGCGGCCCGGGCTGCTCCCCACCACCGCCACCATGTCCTCCTTCTCAGAATCGGCGCTGGAA

AAGAAGCTCTCAGAGCTGAGCAACTCTCAGCAGAGCGTGCAGACCCTCTCCCTGTGGCTCATCCACCACCGCAAGCACGCAGGACCCATCGTCTCCGTGT

GGCACCGCGAGCTCCGCAAAG - UNI3524 - - UNI10097 - CCAAATCAAATAGAAAGCTTACTTTTCTATACTTAGCAAATGATGTCATCCAA

AACAGTAAAAGGAAAGGACCTGAGTTCACAAGAGAATTTGAGTCTGTGCTTGTGGATGCTTTTTCTCATGTTGCCAG - UNI3524 - - UNI19620

 - AGAGGCAGATGAAGGCTGTAAAAAACCTTTAGAAAGATTGCTGAACATCTGGCAAGAACGAAGTGTGTACGGCGGCGAGTTCATACAGCAGCTGAAG

CTGTCTATGGAGGACTCCAAGAGCCCTCCCCCCAAAG - UNI19620 - CAGCAGAAGAGAAGAAGTCTCTAAAACGAACTTTTCAGCAGATACAAGA

GGAGGAAGATGATGACTACCCTGGAAGCTACTCTCCCCAAGACCCTTCTGCAGGCCCTCTCTTG - UNI12519 - ACTGAGGAGTTAATCAAAGCTT

TGCAGGATCTGGAAAATGCTGCGTCAGGGGATGCTACTGTCCGACAGAAGATCGCTTCCCTGCCTCAGGAAGTGCAAGACGTGTCGCTGCTAGAGAAAAT

TACAG - UNI12239 - - UNI21367 - - UNI32140 - ATGCAGAAACTGAGGCATGA
Translation
MSSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKA - UNI3524 - - UNI10097 - AKSNRKLTFLYLANDVIQNSKRK

GPEFTREFESVLVDAFSHVAR - UNI3524 - - UNI19620 - READEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKA - UNI1

9620 - AAEEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLL - UNI12519 - TEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKI

TD - UNI12239 - - UNI21367 - - UNI32140 - DAETEA
Transcript ENSMUST00000029180
Sequence
GGTTAAAGCGCATTTTCGGTGTTCGAGGACCTGGATTTGTTCCCTCGGCCTGGCCGGCTAGAAGTCAGGGACCAAGGATACTGCCGCCTCCTAAGGATCG

TTTTCCTCCGGCTCCGAAGCCTCTCGGCGCCCGGCTGTGGCCCTTGCCCTTTGACCCCCGTGGCGGCGGGGTGAGAGGTCGGGTGGCCATCTTGTGGCGG

CGGCGCGGGCGGCTGTTACTGCGGAGACCTGTCCCCTCCCCCCACCTGGTACCCCGAGCTGTCTGTCAGTCGGCGGAGAGCCCTGCAGCCTGTCAGCGGA

GGCCTGGGCCGAGTGCGGTCGCTTTCCCCGTCTCATCGGGCGGCCCGGGCTGCTCCCCACCACCGCCACCATGTCCTCCTTCTCAGAATCGGCGCTGGAA

AAGAAGCTCTCAGAGCTGAGCAACTCTCAGCAGAGCGTGCAGACCCTCTCCCTGTGGCTCATCCACCACCGCAAGCACGCAGGACCCATCGTCTCCGTGT

GGCACCGCGAGCTCCGCAAAG - UNI3524 - - UNI10097 - CCAAATCAAATAGAAAGCTTACTTTTCTATACTTAGCAAATGATGTCATCCAA

AACAGTAAAAGGAAAGGACCTGAGTTCACAAGAGAATTTGAGTCTGTGCTTGTGGATGCTTTTTCTCATGTTGCCAG - UNI3524 - - UNI19620

 - AGAGGCAGATGAAGGCTGTAAAAAACCTTTAGAAAGATTGCTGAACATCTGGCAAGAACGAAGTGTGTACGGCGGCGAGTTCATACAGCAGCTGAAG

CTGTCTATGGAGGACTCCAAGAGCCCTCCCCCCAAAG - UNI19620 - CAGCAGAAGAGAAGAAGTCTCTAAAACGAACTTTTCAGCAGATACAAGA

GGAGGAAGATGATGACTACCCTGGAAGCTACTCTCCCCAAGACCCTTCTGCAGGCCCTCTCTTG - UNI12519 - ACTGAGGAGTTAATCAAAGCTT

TGCAGGATCTGGAAAATGCTGCGTCAGGGGATGCTACTGTCCGACAGAAGATCGCTTCCCTGCCTCAGGAAGTGCAAGACGTGTCGCTGCTAGAGAAAAT

TACAG - UNI12239 - ACAAAGAGGCAGCTGAACGTCTTTCAAAAACAGTAGATGAAGCATGTCTGTTACTAGCGGAATATAACGGGCGCCTGGCAG

CGGAACTGGAAGACCGGCGCCAGCTGGCTCGGATGCTGGTGGAATACACCCAGAACCAGAAAGAGGTTTTGTCAGAAAAAGAGAAAAAACTAGAA - UN

I21367 - GAGTATAAACAGAAGCTTGCTCGAGTAACCCAGGTCCGCAAGGAACTCAAGTCCCACATTCAGAGCTTGCCAGACCTTTCGCTGTTGCCTA

ATGTCACAGGGGGCCTGGCACCTCTGCCCTCTGCTGGTGACCTCTTTTCAACTGACTAGGACAGGTATCATGCCCCAGGTTCCCATGTGTGCCAGAGAAA

AGAAGCAAGTCACTGCTGGAGACAGTCCCCTGCCCCAGCTCCATCTCTTCAGCCAGCATCTGCCTCAGTAATGAAGCGGGGAACTCTGACTTCTTACTCT

CCTCCGGCTCCCCTCTGAGCATGGTTCAGAGCCATGCAGATGGACTCAGTTTTGATTCATATTTGCTAAGAACACAGACTCTCCCTCCCACTCATGTCTC

TTGCCACTGCTGCTTTTCCATCTTTCGCTCTCTTACACCCATAAGCCATGAAAATCATGTGTACTTCTGGAAGCTTTCAAGAGAAGCTTGCCTCAGTGAC

AGCACATGCCATGGAAGTCTGAGCTGGCCTTGACCAGGTTCAGAACAGGCTCCCAATGAGGACTCAGGCTGCAGGGATTGGGCTTTCCTGGCCACCATTG

CTCACAAGGTCGGCAGCATAGCTTTGCCACAAAGAGTTTGCCAAATTGCCGACATTTCCTGATCTAAACACTTCTGTTAGAGAAGTGTTGTCATGGTTAG

GTGTGTTTATTTTTCGAGCATTCTAGAGAATCCAACAGTAAGATTCGAAGCTGATCTGAGACATAAAAGTTATAGCGCAGGTACAGAGTGGCAGGGCTCA

CAAGTCGTTTGCCAGGCTTCTCACCACAGCCTTCCCTGCCACATTGCTCCAGGGTCCCCAGTTTCAGAGCACCTTCCTAAAGCAGGACCCTCTGTCCCCT

GGGGCTGGGAAGGGAGCTGTTGGGATAGCATGCCCAGGCTGATAACTGCTCCACAGCTGGAGTCTGGGCTCTCGTGCATGTTGCTCTCACCCTGAAGCTT

ACAATAACGCCACCATGTGGACGCATCCACAGCATGGTGACTGGACTTGAACATCTCTACAGATAGGACACTGAGCGTGCCAGGCAGTTCCTGCCACTAT

ATGCATCCTTGCTCCCATGCAGAGAGAGGAGTACTCAAACAACTCACCTCCAGCAGAGGAAGGGAGTGGAGGGAGACTAATTTGGGGTTGAATTCCATTA

TCATGCCAGCTGACATTATGACTGAATGATGTAGTTGCGATTTTTACGTCTAGTAAAGAGTGGGCCTGGCCCTGGAAATGACTGTAATCTGGCAGGCTTA

TATTTGACATTGGAAAGGGCAGAAACCATTTTGTCCTACTAGTGTGATAGGAATTGTCGCCCAGAGCTGAAGTCCAAAAGCCATAAAAAGGAATTCAGTG

AAGGGGCCTGAGAAGCTTCGTTGCTTTAAGTTGCTGTTTTCAGGATCACCAAAAAAAAAAAAGCACACATCGTTTTTACACGTTAAAGCAAATCTGTGTG

TCACCAAATAGGCAGGCTTTGGTTGAAGAAGCCGCCCCACCTGCTATGAGATGGGACTCAGTTCCACTCTGTCCAGCCTGGTCTTCGTGGAAGCTGTTAT

TCACAGAGTGCAGGCTGCTGTTTGCTTGTTCACTCTGCCTTTTCTGTCAGCATCCTTTTCTCCAGAGGTTACAGGACAGCACTGACTCAGGTGAAACCCC

TGTCTCTGCTGCGGAACACCTCCCTACACACCACGCCACTTTACTGTCACATGCACACACCACTCTGAACACCCTCCAGACACTGCTTTCCCACAAAACA

GACCAAAAGACTGTAGCAGCTCTGCTCTGATGACAACTTAGTGGGGTCAGCTCAATGGTGTTTATTCTTTGGAGTCTCTGACCAGCAGTCAGTGCGTAAC

TCTTACAGCAGGATCAAGACGTGACCAGTAGCGATTATGTAAATGAATGTGTTGGCCTCATTACACCACTTCCAGCAGATTTCCTGTGAGGAAGTTAGTT

TCGTTTTAATGAAATGCTTCAGTTTTTAATCTTCCTTGTTGTGTGCCTCCACCATGCCCCCAGTCTCCCAACTGTGTGCGAACTTCCCTTGTTTAACTTA

AGTGAAACTTTTGTCCCTGAGAGTTGATCTGGCGGGTGGGGTGGGTGACTTCTGGTTTTGTGTTTCTTTAGGGCATCCGTAGGCCTCAAGGATCTTTCCT

TTAGGGTCATATTCCTCAGAAAGTCTTCAGTCTTTCTTTGTTTTTGTTTTGTTTTTCTTAAAGGATATTTTTAAAGCTTAAATTTGTATATTAATTTAGG

ACTTTATTTAGAAGTATAGGCTGTCATTGGTGGCAGCAGTATATTCTGAAATGTCTCATAGATATATATTTTTGAATAAAGATGGTGTTGTTGAACAACA

TTCTGTGATGTTTCTTCTCCCTGCCTCGTGCAGTGATTAGTGATCATCAATGGAGGGCGCTCTGTCTGCACAGAATCTTCCCCTGGGGGCTGGTAGTGGT

ACATACGCAAGACAACTGGTTGAACTTACTCTCCAAGTCTCTCTTGGAGTTTGATTGGCCAGTTAGCAGTCTATACTGTAGCAGAGAGCGCCAACTGGGT

TTCATCCTTGTATAGGCTGAAGACTGGTTGGGGGGTGGGGAGGACTTGTGATGTCCCCCCACACACAGAGGATGTCTTGAGAGGCCTTTGGTTGCAGTCT

TTTCAGTCACACCAGCAGGCCTTGTGGGAATTGTTTGATTTGCAGTATGGTGAAGCTGCTCTTGGAAAAACGGAAAATAACCAAACATCATCTTTTTTAA

GTGTTTTCATGGACTTCTCTTCTGCTGAGGTTGACATCCAATGGAAGACCCTGATGACTGAGTACTCTGGAGACAGGGTGCTCTGAAGCAGCTGCTGTGG

TCCGGAATGGTTGAGATCTCCCACTAAGTTATGGTGGGGTTACCTGTTTCTCATGATGCAAAGGACTTCCTTTTTAGTAATGGTGGTCCATCAAGACCAC

CTGCAGCTGAAGTCCAAGTTCACTATCAGGAAAGTGTGTGAGTTTTGCCTGCTTGTATGTATGTGCACCATGTACATGCCAGGTGCCTGTAGAGGCCAGA

AGGTGGCATTGGATTCCTTGGAACTGGAATTACAAATGGTTGTGTGCTGGGGATCAAACCTGGGTCTTCTGCAAGAGCCACAAACACTCTTTACTGTTGA

GCCATCTCTCCAGCCCTTCTCCCAACCCCCCACAGTGTTCTGGTTTAATAAAGGTTGAGTGTAAAGTACGAATCT
Translation
MSSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKA - UNI3524 - - UNI10097 - AKSNRKLTFLYLANDVIQNSKRK

GPEFTREFESVLVDAFSHVAR - UNI3524 - - UNI19620 - READEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKA - UNI1

9620 - AAEEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLL - UNI12519 - TEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKI

TD - UNI12239 - DKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKEVLSEKEKKLE - UNI21367 - EYKQKLARVTQ

VRKELKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD
Transcript ENSMUST00000103123
Sequence
GGTTAAAGCGCATTTTCGGTGTTCGAGGACCTGGATTTGTTCCCTCGGCCTGGCCGGCTAGAAGTCAGGGACCAAGGATACTGCCGCCTCCTAAGGATCG

TTTTCCTCCGGCTCCGAAGCCTCTCGGCGCCCGGCTGTGGCCCTTGCCCTTTGACCCCCGTGGCGGCGGGGTGAGAGGTCGGGTGGCCATCTTGTGGCGG

CGGCGCGGGCGGCTGTTACTGCGGAGACCTGTCCCCTCCCCCCACCTGGTACCCCGAGCTGTCTGTCAGTCGGCGGAGAGCCCTGCAGCCTGTCAGCGGA

GGCCTGGGCCGAGTGCGGTCGCTTTCCCCGTCTCATCGGGCGGCCCGGGCTGCTCCCCACCACCGCCACCATGTCCTCCTTCTCAGAATCGGCGCTGGAA

AAGAAGCTCTCAGAGCTGAGCAACTCTCAGCAGAGCGTGCAGACCCTCTCCCTGTGGCTCATCCACCACCGCAAGCACGCAGGACCCATCGTCTCCGTGT

GGCACCGCGAGCTCCGCAAAG - UNI3524 - - UNI10097 - CCAAATCAAATAGAAAGCTTACTTTTCTATACTTAGCAAATGATGTCATCCAA

AACAGTAAAAGGAAAGGACCTGAGTTCACAAGAGAATTTGAGTCTGTGCTTGTGGATGCTTTTTCTCATGTTGCCAG - UNI3524 - - UNI19620

 - AGAGGCAGATGAAGGCTGTAAAAAACCTTTAGAAAGATTGCTGAACATCTGGCAAGAACGAAGTGTGTACGGCGGCGAGTTCATACAGCAGCTGAAG

CTGTCTATGGAGGACTCCAAGAGCCCTCCCCCCAAAG - UNI12519 - - UNI19620 - CAGAAGAGAAGAAGTCTCTAAAACGAACTTTTCAGC

AGATACAAGAGGAGGAAGATGATGACTACCCTGGAAGCTACTCTCCCCAAGACCCTTCTGCAGGCCCTCTCTTG - UNI12519 - ACTGAGGAGTTA

ATCAAAGCTTTGCAGGATCTGGAAAATGCTGCGTCAGGGGATGCTACTGTCCGACAGAAGATCGCTTCCCTGCCTCAGGAAGTGCAAGACGTGTCGCTGC

TAGAGAAAATTACAG - UNI12239 - ACAAAGAGGCAGCTGAACGTCTTTCAAAAACAGTAGATGAAGCATGTCTGTTACTAGCGGAATATAACGGG

CGCCTGGCAGCGGAACTGGAAGACCGGCGCCAGCTGGCTCGGATGCTGGTGGAATACACCCAGAACCAGAAAGAGGTTTTGTCAGAAAAAGAGAAAAAAC

TAGAA - UNI21367 - GAGTATAAACAGAAGCTTGCTCGAGTAACCCAGGTCCGCAAGGAACTCAAGTCCCACATTCAGAGCTTGCCAGACCTTTCG

CTGTTGCCTAATGTCACAGGGGGCCTGGCACCTCTGCCCTCTGCTGGTGACCTCTTTTCAACTGACTAGGACAGGTATCATGCCCCAGGTTCCCATGTGT

GCCAGAGAAAAGAAGCAAGTCACTGCTGGAGACAGTCCCCTGCCCCAGCTCCATCTCTTCAGCCAGCATCTGCCTCAGTAATGAAGCGGGGAACTCTGAC

TTCTTACTCTCCTCCGGCTCCCCTCTGAGCATGGTTCAGAGCCATGCAGATGGACTCAGTTTTGATTCATATTTGCTAAGAACACAGACTCTCCCTCCCA

CTCATGTCTCTTGCCACTGCTGCTTTTCCATCTTTCGCTCTCTTACACCCATAAGCCATGAAAATCATGTGTACTTCTGGAAGCTTTCAAGAGAAGCTTG

CCTCAGTGACAGCACATGCCATGGAAGTCTGAGCTGGCCTTGACCAGGTTCAGAACAGGCTCCCAATGAGGACTCAGGCTGCAGGGATTGGGCTTTCCTG

GCCACCATTGCTCACAAGGTCGGCAGCATAGCTTTGCCACAAAGAGTTTGCCAAATTGCCGACATTTCCTGATCTAAACACTTCTGTTAGAGAAGTGTTG

TCATGGTTAGGTGTGTTTATTTTTCGAGCATTCTAGAGAATCCAACAGTAAGATTCGAAGCTGATCTGAGACATAAAAGTTATAGCGCAGGTACAGAGTG

GCAGGGCTCACAAGTCGTTTGCCAGGCTTCTCACCACAGCCTTCCCTGCCACATTGCTCCAGGGTCCCCAGTTTCAGAGCACCTTCCTAAAGCAGGACCC

TCTGTCCCCTGGGGCTGGGAAGGGAGCTGTTGGGATAGCATGCCCAGGCTGATAACTGCTCCACAGCTGGAGTCTGGGCTCTCGTGCATGTTGCTCTCAC

CCTGAAGCTTACAATAACGCCACCATGTGGACGCATCCACAGCATGGTGACTGGACTTGAACATCTCTACAGATAGGACACTGAGCGTGCCAGGCAGTTC

CTGCCACTATATGCATCCTTGCTCCCATGCAGAGAGAGGAGTACTCAAACAACTCACCTCCAGCAGAGGAAGGGAGTGGAGGGAGACTAATTTGGGGTTG

AATTCCATTATCATGCCAGCTGACATTATGACTGAATGATGTAGTTGCGATTTTTACGTCTAGTAAAGAGTGGGCCTGGCCCTGGAAATGACTGTAATCT

GGCAGGCTTATATTTGACATTGGAAAGGGCAGAAACCATTTTGTCCTACTAGTGTGATAGGAATTGTCGCCCAGAGCTGAAGTCCAAAAGCCATAAAAAG

GAATTCAGTGAAGGGGCCTGAGAAGCTTCGTTGCTTTAAGTTGCTGTTTTCAGGATCACCAAAAAAAAAAAAGCACACATCGTTTTTACACGTTAAAGCA

AATCTGTGTGTCACCAAATAGGCAGGCTTTGGTTGAAGAAGCCGCCCCACCTGCTATGAGATGGGACTCAGTTCCACTCTGTCCAGCCTGGTCTTCGTGG

AAGCTGTTATTCACAGAGTGCAGGCTGCTGTTTGCTTGTTCACTCTGCCTTTTCTGTCAGCATCCTTTTCTCCAGAGGTTACAGGACAGCACTGACTCAG

GTGAAACCCCTGTCTCTGCTGCGGAACACCTCCCTACACACCACGCCACTTTACTGTCACATGCACACACCACTCTGAACACCCTCCAGACACTGCTTTC

CCACAAAACAGACCAAAAGACTGTAGCAGCTCTGCTCTGATGACAACTTAGTGGGGTCAGCTCAATGGTGTTTATTCTTTGGAGTCTCTGACCAGCAGTC

AGTGCGTAACTCTTACAGCAGGATCAAGACGTGACCAGTAGCGATTATGTAAATGAATGTGTTGGCCTCATTACACCACTTCCAGCAGATTTCCTGTGAG

GAAGTTAGTTTCGTTTTAATGAAATGCTTCAGTTTTTAATCTTCCTTGTTGTGTGCCTCCACCATGCCCCCAGTCTCCCAACTGTGTGCGAACTTCCCTT

GTTTAACTTAAGTGAAACTTTTGTCCCTGAGAGTTGATCTGGCGGGTGGGGTGGGTGACTTCTGGTTTTGTGTTTCTTTAGGGCATCCGTAGGCCTCAAG

GATCTTTCCTTTAGGGTCATATTCCTCAGAAAGTCTTCAGTCTTTCTTTGTTTTTGTTTTGTTTTTCTTAAAGGATATTTTTAAAGCTTAAATTTGTATA

TTAATTTAGGACTTTATTTAGAAGTATAGGCTGTCATTGGTGGCAGCAGTATATTCTGAAATGTCTCATAGATATATATTTTTGAATAAAGATGGTGTTG

TTGAACAACATTCTGTGATGTTTCTTCTCCCTGCCTCGTGCAGTGATTAGTGATCATCAATGGAGGGCGCTCTGTCTGCACAGAATCTTCCCCTGGGGGC

TGGTAGTGGTACATACGCAAGACAACTGGTTGAACTTACTCTCCAAGTCTCTCTTGGAGTTTGATTGGCCAGTTAGCAGTCTATACTGTAGCAGAGAGCG

CCAACTGGGTTTCATCCTTGTATAGGCTGAAGACTGGTTGGGGGGTGGGGAGGACTTGTGATGTCCCCCCACACACAGAGGATGTCTTGAGAGGCCTTTG

GTTGCAGTCTTTTCAGTCACACCAGCAGGCCTTGTGGGAATTGTTTGATTTGCAGTATGGTGAAGCTGCTCTTGGAAAAACGGAAAATAACCAAACATCA

TCTTTTTTAAGTGTTTTCATGGACTTCTCTTCTGCTGAGGTTGACATCCAATGGAAGACCCTGATGACTGAGTACTCTGGAGACAGGGTGCTCTGAAGCA

GCTGCTGTGGTCCGGAATGGTTGAGATCTCCCACTAAGTTATGGTGGGGTTACCTGTTTCTCATGATGCAAAGGACTTCCTTTTTAGTAATGGTGGTCCA

TCAAGACCACCTGCAGCTGAAGTCCAAGTTCACTATCAGGAAAGTGTGTGAGTTTTGCCTGCTTGTATGTATGTGCACCATGTACATGCCAGGTGCCTGT

AGAGGCCAGAAGGTGGCATTGGATTCCTTGGAACTGGAATTACAAATGGTTGTGTGCTGGGGATCAAACCTGGGTCTTCTGCAAGAGCCACAAACACTCT

TTACTGTTGAGCCATCTCTCCAGCCCTTCTCCCAACCCCCCACAGTGTTCTGGTTTAATAAAGGTTGAGTGTAAAGTACGAATCT
Translation
MSSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKA - UNI3524 - - UNI10097 - AKSNRKLTFLYLANDVIQNSKRK

GPEFTREFESVLVDAFSHVAR - UNI3524 - - UNI19620 - READEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKA - UNI1

2519 - - UNI19620 - AEEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLL - UNI12519 - TEELIKALQDLENAASGDATVRQKIASLP

QEVQDVSLLEKITD - UNI12239 - DKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKEVLSEKEKKLE - UNI21367 -

 EYKQKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD
Transcript ENSMUST00000099135
Sequence
GGTTAAAGCGCATTTTCGGTGTTCGAGGACCTGGATTTGTTCCCTCGGCCTGGCCGGCTAGAAGTCAGGGACCAAGGATACTGCCGCCTCCTAAGGATCG

TTTTCCTCCGGCTCCGAAGCCTCTCGGCGCCCGGCTGTGGCCCTTGCCCTTTGACCCCCGTGGCGGCGGGGTGAGAGGTCGGGTGGCCATCTTGTGGCGG

CGGCGCGGGCGGCTGTTACTGCGGAGACCTGTCCCCTCCCCCCACCTGGTACCCCGAGCTGTCTGTCAGTCGGCGGAGAGCCCTGCAGCCTGTCAGCGGA

GGCCTGGGCCGAGTGCGGTCGCTTTCCCCGTCTCATCGGGCGGCCCGGGCTGCTCCCCACCACCGCCACCATGTCCTCCTTCTCAGAATCGGCGCTGGAA

AAGAAGCTCTCAGAGCTGAGCAACTCTCAGCAGAGCGTGCAGACCCTCTCCCTGTGGCTCATCCACCACCGCAAGCACGCAGGACCCATCGTCTCCGTGT

GGCACCGCGAGCTCCGCAAAG - UNI3524 - - UNI10097 - CCAAATCAAATAGAAAGCTTACTTTTCTATACTTAGCAAATGATGTCATCCAA

AACAGTAAAAGGAAAGGACCTGAGTTCACAAGAGAATTTGAGTCTGTGCTTGTGGATGCTTTTTCTCATGTTGCCAG - UNI3524 - - UNI19620

 - AGAGGCAGATGAAGGCTGTAAAAAACCTTTAGAAAGATTGCTGAACATCTGGCAAGAACGAAGTGTGTACGGCGGCGAGTTCATACAGCAGCTGAAG

CTGTCTATGGAGGACTCCAAGAGCCCTCCCCCCAAAG - UNI19620 - CAGCAGAAGAGAAGAAGTCTCTAAAACGAACTTTTCAGCAGATACAAGA

GGAGGAAGATGATGACTACCCTGGAAGCTACTCTCCCCAAGACCCTTCTGCAGGCCCTCTCTTG - UNI12519 - ACTGAGGAGTTAATCAAAGCTT

TGCAGGATCTGGAAAATGCTGCGTCAGGGGATGCTACTGTCCGACAGAAGATCGCTTCCCTGCCTCAGGAAGTGCAAGACGTGTCGCTGCTAGAGAAAAT

TACAG - UNI12239 - ACAAAGAGGCAGCTGAACGTCTTTCAAAAACAGTAGATGAAGCATGTCTGTTACTAGCGGAATATAACGGGCGCCTGGCAG

CGGAACTGGAAGACCGGCGCCAGCTGGCTCGGATGCTGGTGGAATACACCCAGAACCAGAAAGAGGTTTTGTCAGAAAAAGAGAAAAAACTAGAA CGTC

TTACTCAGCAGCTCCAGCCCTGCTCTGATCCCCAGAATGTATCCTTCTGA
Translation
MSSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKA - UNI3524 - - UNI10097 - AKSNRKLTFLYLANDVIQNSKRK

GPEFTREFESVLVDAFSHVAR - UNI3524 - - UNI19620 - READEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKA - UNI1

9620 - AAEEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLL - UNI12519 - TEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKI

TD - UNI12239 - DKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKEVLSEKEKKLE RLTQQLQPCSDPQNVSF
Transcript ENSMUST00000109518
Sequence
GGTCGGGTGGCCATCTTGTGGCGGCGGCGCGGGCGGCTGTTACTGCGGAGACCTGTCCCCTCCCCCCACCTGGTACCCCGAGCTGTCTGTCAGTCGGCGG

AGAGCCCTGCAGCCTGTCAGCGGAGGCCTGGGCCGAGTGCGGTCGCTTTCCCCGTCTCATCGGGCGGCCCGGGCTGCTCCCCACCACCGCCACCATGTCC

TCCTTCTCAGAATCGGCGCTGGAAAAGAAGCTCTCAGAGCTGAGCAACTCTCAGCAGAGCGTGCAGACCCTCTCCCTGTGGCTCATCCACCACCGCAAGC

ACGCAGGACCCATCGTCTCCGTGTGGCACCGCGAGCTCCGCAAAG - UNI3524 - - UNI10097 - CCAAATCAAATAGAAAGCTTACTTTTCTA

TACTTAGCAAATGATGTCATCCAAAACAGTAAAAGGAAAGGACCTGAGTTCACAAGAGAATTTGAGTCTGTGCTTGTGGATGCTTTTTCTCATGTTGCCA

G - UNI3524 - - UNI19620 - AGAGGCAGATGAAGGCTGTAAAAAACCTTTAGAAAGATTGCTGAACATCTGGCAAGAACGAAGTGTGTACGGC

GGCGAGTTCATACAGCAGCTGAAGCTGTCTATGGAGGACTCCAAGAGCCCTCCCCCCAAAG - UNI19620 - CAGCAGAAGAGAAGAAGTCTCTAAA

ACGAACTTTTCAGCAGATACAAGAGGAGGAAGATGATGACTACCCTGGAAGCTACTCTCCCCAAGACCCTTCTGCAGGCCCTCTCTTG - UNI12519 

- ACTGAGGAGTTAATCAAAGCTTTGCAGGATCTGGAAAATGCTGCGTCAGGGGATGCTACTGTCCGACAGAAGATCGCTTCCCTGCCTCAGGAAGTGCA

AGACGTGTCGCTGCTAGAGAAAATTACAG - UNI12239 - ACAAAGAGGCAGCTGAACGTCTTTCAAAAACAGTAGATGAAGCATGTCTGTTACTAG

CGGAATATAACGGGCGCCTGGCAGCGGAACTGGAAGACCGGCGCCAGCTGGCTCGGATGCTGGTGGAATACACCCAGAACCAGAAAGAGGTTTTGTCAGA

AAAAGAGAAAAAACTAGAA CGTCTTACTCAGCAGCTCCAGCCCTGCTCTGATCCCCAGAATGTATCCTTCTGAAATGTGGTAGCTGCCCTGGAGCTGGC

AGGGAGAGAGGGACAG - UNI21367 - GAGTATAAACAGAAGCTTGCTCGAGTAACCCAGGTCCGCAAGGAACTCAAGTCCCACATTCAGAGCTTGC

CAGACCTTTCGCTGTTGCCTAATGTCACAGGGGGCCTGGCACCTCTGCCCTCTGCTGGTGACCTCTTTTCAACTGACTAGGACAGGTATCATGCCCCAGG

TTCCCATGTGTGCCAGAGAAAAGAAGCAAGTCACTGCTGGAGACAGTCCCCTGCCCCAGCTCCATCTCTTCAGCCAGCATCTGCCTCAGTAATGAAGCGG

GGAACTCTGACTTCTTACTCTCCTCCGGCTCCCCTCTGAGCATGGTTCAGAGCCATGCAGATGGACTCAGTTTTGATTCATATTTGCTAAGAACACAGAC

TCTCCCTCCCACTCATGTCTCTTGCCACTGCTGCTTTTCCATCTTTCGCTCTCTTACACCCATAAGCCATGAAAATCATGTGTACTTCTGGAAGCTTTCA

AGAGAAGCTTGCCTCAGTGACAGCACATGCCATGGAAGTCTGAGCTGGCCTTGACCAGGTTCAGAACAGGCTCCCAATGAGGACTCAGGCTGCAGGGATT

GGGCTTTCCTGGCCACCATTGCTCACAAGGTCGGCAGCATAGCTTTGCCACAAAGAGTTTGCCAAATTGCCGACATTTCCTGATCTAAACACTTCTGTTA

GAGAAGTGTTGTCATGGTTAGGTGTGTTTATTTTTCGAGCATTCTAGAGAATCCAACAGTAAGATTCGAAGCTGATCTGAGACATAAAAGTTATAGCGCA

GGTACAGAGTGGCAGGGCTCACAAGTCGTTTGCCAGGCTTCTCACCACAGCCTTCCCTGCCACATTGCTCCAGGGTCCCCAGTTTCAGAGCACCTTCCTA

AAGCAGGACCCTCTGTCCCCTGGGGCTGGGAAGGGAGCTGTTGGGATAGCATGCCCAGGCTGATAACTGCTCCACAGCTGGAGTCTGGGCTCTCGTGCAT

GTTGCTCTCACCCTGAAGCTTACAATAACGCCACCATGTGGACGCATCCACAGCATGGTGACTGGACTTGAACATCTCTACAGATAGGACACTGAGCGTG

CCAGGCAGTTCCTGCCACTATATGCATCCTTGCTCCCATGCAGAGAGAGGAGTACTCAAACAACTCACCTCCAGCAGAGGAAGGGAGTGGAGGGAGACTA

ATTTGGGGTTGAATTCCATTATCATGCCAGCTGACATTATGACTGAATGATGTAGTTGCGATTTTTACGTCTAGTAAAGAGTGGGCCTGGCCCTGGAAAT

GACTGTAATCTGGCAGGCTTATATTTGACATTGGAAAGGGCAGAAACCATTTTGTCCTACTAGTGTGATAGGAATTGTCGCCCAGAGCTGAAGTCCAAAA

GCCATAAAAAGGAATTCAGTGAAGGGGCCTGAGAAGCTTCGTTGCTTTAAGTTGCTGTTTTCAGGATCACCAAAAAAAAAAAAGCACACATCGTTTTTAC

ACGTTAAAGCAAATCTGTGTGTCACCAAATAGGCAGGCTTTGGTTGAAGAAGCCGCCCCACCTGCTATGAGATGGGACTCAGTTCCACTCTGTCCAGCCT

GGTCTTCGTGGAAGCTGTTATTCACAGAGTGCAGGCTGCTGTTTGCTTGTTCACTCTGCCTTTTCTGTCAGCATCCTTTTCTCCAGAGGTTACAGGACAG

CACTGACTCAGGTGAAACCCCTGTCTCTGCTGCGGAACACCTCCCTACACACCACGCCACTTTACTGTCACATGCACACACCACTCTGAACACCCTCCAG

ACACTGCTTTCCCACAAAACAGACCAAAAGACTGTAGCAGCTCTGCTCTGATGACAACTTAGTGGGGTCAGCTCAATGGTGTTTATTCTTTGGAGTCTCT

GACCAGCAGTCAGTGCGTAACTCTTACAGCAGGATCAAGACGTGACCAGTAGCGATTATGTAAATGAATGTGTTGGCCTCATTACACCACTTCCAGCAGA

TTTCCTGTGAGGAAGTTAGTTTCGTTTTAATGAAATGCTTCAGTTTTTAATCTTCCTTGTTGTGTGCCTCCACCATGCCCCCAGTCTCCCAACTGTGTGC

GAACTTCCCTTGTTTAACTTAAGTGAAACTTTTGTCCCTGAGAGTTGATCTGGCGGGTGGGGTGGGTGACTTCTGGTTTTGTGTTTCTTTAGGGCATCCG

TAGGCCTCAAGGATCTTTCCTTTAGGGTCATATTCCTCAGAAAGTCTTCAGTCTTTCTTTGTTTTTGTTTTGTTTTTCTTAAAGGATATTTTTAAAGCTT

AAATTTGTATATTAATTTAGGACTTTATTTAGAAGTATAGGCTGTCATTGGTGGCAGCAGTATATTCTGAAATGTCTCATAGATATATATTTTTGAATAA

AGATGGTGTTGTTGAACAACATTCTGTGATGTTTCTTCTCCCTGCCTCGTGCAGTGATTAGTGATCATCAATGGAGGGCGCTCTGTCTGCACAGAATCTT

CCCCTGGGGGCTGGTAGTGGTACATACGCAAGACAACTGGTTGAACTTACTCTCCAAGTCTCTCTTGGAGTTTGATTGGCCAGTTAGCAGTCTATACTGT

AGCAGAGAGCGCCAACTGGGTTTCATCCTTGTATAGGCTGAAGACTGGTTGGGGGGTGGGGAGGACTTGTGATGTCCCCCCACACACAGAGGATGTCTTG

AGAGGCCTTTGGTTGCAGTCTTTTCAGTCACACCAGCAGGCCTTGTGGGAATTGTTTGATTTGCAGTATGGTGAAGCTGCTCTTGGAAAAACGGAAAATA

ACCAAACATCATCTTTTTTAAGTGTTTTCATGGACTTCTCTTCTGCTGAGGTTGACATCCAATGGAAGACCCTGATGACTGAGTACTCTGGAGACAGGGT

GCTCTGAAGCAGCTGCTGTGGTCCGGAATGGTTGAGATCTCCCACTAAGTTATGGTGGGGTTACCTGTTTCTCATGATGCAAAGGACTTCCTTTTTAGTA

ATGGTGGTCCATCAAGACCACCTGCAGCTGAAGTCCAAGTTCACTATCAGGAAAGTGTGTGAGTTTTGCCTGCTTGTATGTATGTGCACCATGTACATGC

CAGGTGCCTGTAGAGGCCAGAAGGTGGCATTGGATTCCTTGGAACTGGAATTACAAATGGTTGTGTGCTGGGGATCAAACCTGGGTCTTCTGCAAGAGCC

ACAAACACTCTTTACTGTTGAGCCATCTCTCCAGCCCTTCTCCCAACCCCCCACAGTGTTCTGGTTTAATAAAGGTTGAGTGTAAAGTACGAATCTAAGT

AAACAAGA
Translation
MSSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKA - UNI3524 - - UNI10097 - AKSNRKLTFLYLANDVIQNSKRK

GPEFTREFESVLVDAFSHVAR - UNI3524 - - UNI19620 - READEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKA - UNI1

9620 - AAEEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLL - UNI12519 - TEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKI

TD - UNI12239 - DKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKEVLSEKEKKLE RLTQQLQPCSDPQNVSF - UNI2

1367 - 
Transcript ENSMUST00000109517
Sequence
GGCTCACTGCGCCGGCGCGCGGGCGCGAGCGGTTAAAGCGCATTTTCGGTGTTCGAGGACCTGGATTTGTTCCCTCGGCCTGGCCGGCTAGAAGTCAGGG

ACCAAGGATACTGCCGCCTCCTAAGGATCGTTTTCCTCCGGCTCCGAAGCCTCTCGGCGCCCGGCTGTGGCCCTTGCCCTTTGACCCCCGTGGCGGCGGG

GTGAGAGGTCGGGTGGCCATCTTGTGGCGGCGGCGCGGGCGGCTGTTACTGCGGAGACCTGTCCCCTCCCCCCACCTGGTACCCCGAGCTGTCTGTCAGT

CGGCGGAGAGCCCTGCAGCCTGTCAGCGGAGGCCTGGGCCGAGTGCGGTCGCTTTCCCCGTCTCATCGGGCGGCCCGGGCTGCTCCCCACCACCGCCACC

ATGTCCTCCTTCTCAGAATCGGCGCTGGAAAAGAAGCTCTCAGAGCTGAGCAACTCTCAGCAGAGCGTGCAGACCCTCTCCCTGTGGCTCATCCACCACC

GCAAGCACGCAGGACCCATCGTCTCCGTGTGGCACCGCGAGCTCCGCAAAG - UNI3524 - - UNI10097 - CCAAATCAAATAGAAAGCTTACT

TTTCTATACTTAGCAAATGATGTCATCCAAAACAGTAAAAGGAAAGGACCTGAGTTCACAAGAGAATTTGAGTCTGTGCTTGTGGATGCTTTTTCTCATG

TTGCCAG - UNI3524 - - UNI19620 - AGAGGCAGATGAAGGCTGTAAAAAACCTTTAGAAAGATTGCTGAACATCTGGCAAGAACGAAGTGTG

TACGGCGGCGAGTTCATACAGCAGCTGAAGCTGTCTATGGAGGACTCCAAGAGCCCTCCCCCCAAAG - UNI19620 - CAGCAGAAGAGAAGAAGTC

TCTAAAACGAACTTTTCAGCAGATACAAGAGGAGGAAGATGATGACTACCCTGGAAGCTACTCTCCCCAAGACCCTTCTGCAGGCCCTCTCTTG - UNI

12519 - ACTGAGGAGTTAATCAAAGCTTTGCAGGATCTGGAAAATGCTGCGTCAGGGGATGCTACTGTCCGACAGAAGATCGCTTCCCTGCCTCAGGA

AGTGCAAGACGTGTCGCTGCTAGAGAAAATTACAG - UNI12239 - ACAAAGAGGCAGCTGAACGTCTTTCAAAAACAGTAGATGAAGCATGTCTGT

TACTAGCGGAATATAACGGGCGCCTGGCAGCGGAACTGGAAGACCGGCGCCAGCTGGCTCGGATGCTGGTGGAATACACCCAGAACCAGAAAGAGGTTTT

GTCAGAAAAAGAGAAAAAACTAGAA AAGGTTCTCTGTGCATGCTTGTCAATGGCTTTAGTGATTAAGCTGACCAGTCCG
Translation
 - UNI3524 - - UNI10097 -  - UNI3524 - - UNI19620 - MEDSKSPPPKA - UNI19620 - AAEEKKSLKRTFQQIQEEEDDDY

PGSYSPQDPSAGPLL - UNI12519 - TEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKITD - UNI12239 - DKEAAERLSKTVDE

ACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKEVLSEKEKKLE KVLCACLSMALVIKLTSP

For any suggestions or comments, please send an email to unitrap@crg.es