Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027660 (Skil)
Chromosomal location
Chr 3: 30993980 - 31021499 (+)
Description
SKI-like Gene [Source:MGI (curated);Acc:Skil-001]
RefSeq_dna
NM_011386 
RefSeq_peptide
NP_035516.2 NP_001034179.1 
UniGene
Mm.468161 Mm.15406 
MGI
MGI:106203 
Uniprot/SWISSPROT
Q60665 
Uniprot/SPTREMBL
Q3TQJ9 Q3TRA0 Q60979 Q78E91 Q3TB81 
Human Ortholog
ENSG00000136603 (SKIL)
Omim not available
UniTrap UNI12068
Vector Insertion
Chr 3: 30993982 - 30994080
Public Clones W215F02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16469
Vector Insertion
Chr 3: 30994080 - 30995624
Public Clones (sanger) 3SD082F03 (ggtc) 3SE091D11 (ggtc) PST17183-NR (escells) PST21650-NL (escells)
PST22430-NR (escells) IST15002F4 (tigm) IST14603C6 (tigm) IST14222B10 (tigm)
IST14993B10 (tigm) IST14765E4 (tigm) IST14764E6 (tigm)
Private Clones OST460292 (lexicon) OST390597 (lexicon) OST292776 (lexicon) OST237024 (lexicon)
OST218981 (lexicon) OST185137 (lexicon) OST62406 (lexicon) OST51929 (lexicon)
OST32803 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8170
Vector Insertion
Chr 3: 30995624 - 30997342
Public Clones RRH119 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14823
Vector Insertion
Chr 3: 30996113 - 30996191
Public Clones PST9218-NL (escells) PST21381-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19537
Vector Insertion
Chr 3: 30997342 - 31010546
Public Clones IST12607B12 (tigm) IST13333A9 (tigm)
Private Clones OST389338 (lexicon) OST379471 (lexicon) OST302941 (lexicon) OST211418 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25802
Vector Insertion
Chr 3: 31012563 - 31015737
Public Clones not available
Private Clones OST165514 (lexicon)
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18489
Vector Insertion
Chr 3: 31017376 - 31017914
Public Clones not available
Private Clones OST422602 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118204
Sequence
CACCATTTTCAGGGACGATACCTGCCTCTTCTTTTTTGGTGTTCTTGGCAAAAATTAAACCCATTGCGTCATTGTAACTCATGTTTGGGTGTAGTTTCAG

GATACAGTCATGGTATAAACTTCCCACATGCTTTGCTTAAAAAACAAAACCAACCAAACTCAACCATTACACCGAACTTTGGACTTCTTGAATTGAGCTT

TATTTTAATATAAATACCTGAAGTGATTTTCTCAGAAGTGTGCTTACGATTATATTCTTATTTGTTATTAGAAGCAAACAAAACTGAGAAGTTTTGTAGC

ATTTTCAATTATATCTTAAAGTACAGCTAAACCAAAACAGAGTTGTACAATCTATTGAGTAAGAAAATTCATCTTTGGAAAGTAAACATTTCTAAGTGAG

TCATAAGTATTTGTATACATTCCCCTTTTCTCTTCAGATTAGGAACTGAGAACAACATGCCAGTTGCAGACTTAATCGTTTAAAGCACCAGTGTGGCCAT

GGAAAACCTCCAGTCTAAGTTCTCCTTAGTTCAGGGTTCAAATAAAAAGCTGAACGGCATGGAGGATGATGGCAGTCCTCCTGTGAAAAAAATGATGACC

GACATTCATGCCAATGGGAAAACCCTGACCAAGGTGAAGAAGGAGCACTTAGATGACTATGGAGATGCATCCGTGGAGCCGGATGGCGAGCACGCCAAGC

GAAACCGTGTTTCTCTACCTGAAACTTTAAATTTAAACCCCAGTCTGAAACACACGCTGGCACAATTCCACTTAAGCAGTCAGAGCTCTTTGGGTGGACC

AGCAGCATTTTCTGCTCGATATTCCCAGGAGAGCATGTCACCGACTGTATTCCTGCCTCTTCCCTCTCCTCAGGTTCTTCCCGGCCCTCTTCTCATTCCT

TCTGATAGCTCCACAGAGCTCACTCAGACTCTTTTGGAAGGGGAGTCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCT

TAAACTCTGTCCTCCGAGAATTTTCACTCCAGCAGATAAACACAGTATGTGATGAGCTGTACATCTATTGTTCAAGGTGTACTTCAGACCAGCTTCATAT

CTTAAAGGTCTTAGGGATACTCCCATTTAATGCTCCATCCTGTGGGCTGATCACGTTGACCGATGCACAAAGACTCTGTAATGCTTTACTGCGGCCACGA

ACTTTTCCTCAAAATGGTAGCATACTTCCTGCTAAAAGCTCTCTGGCCCAGTTGAAGGAAACTGGCAGTGCCTTTGAAGTGGAACATGAATGCTTGGGCA

AATGTCAGGGTCTCTTTGCGCCTCAGTTTTATGTTCAGCCCGACGCTCCCTGTATCCAGTGCCTGGAGTGCTGTGGAATGTTTGCTCCCCAGACGTTCGT

CATGCATTCGCACAGATCCCCTGACAAGAGAACTTGCCATTGGGGCTTTGAGTCAGCCAAGTGGCACTGTTACCTTCATGTGAACCAAAAATACCTAGGG

ACACCCGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAATGGAAAGAGAATCCAATCAAAG - UNI8170 - 

- UNI19537 - ACAGATACACCATCGGGAATGGAATTGCCATCATGGTATCCTGTTATAAAACAGGAAGGTGACCATGTTCCCCAGACACATTCATTT

TTACACCCCAG CTACTACCTGTACATGTGTGACAAAGTGGTTGCACCGAATGTGTCGCTCACATCTGCTGCGTCCCAGTCTAAAGAGGCCACCAAGGCA

GAGACAAGTAAGTCCACCTCCAAACAGTCAGAAAAGCCTCATGAGAGTAGTCAGCATCAAAAAACAGTGTCTTACCCAGACGTCTCACTTGAGGAGCAGG

AGAAAATGGATTTAAAAACCAGTAGAGAATTATACAGTTGTTTAG - UNI25802 - ATTCATCAATCTCAAATAATTCTACAAGTAGAAAGAAATCT

GAGTCTGCTGTGTGCAGCTTAGTGAGAGGCACAAGCAAGCGTGATTCAGAAGATTCCTCTCCACTTCTGGTCAGAGATGGTGAAGACGACAAGGGGAAGA

TCATGGAAGACGTGATGAGAACCTATGTAAGACAGCAGGAGAAGCTGAACTCCATTCTGCAGAGGAAGCAGCAGCTGCAGATG GAGGTGGAGATGCTGA

GCAGTTCAAAGGCGATGAAGGAGCTCACTGAAGAGCAGCAGAATCTACAGAAAGAGCTTGAGTCGTTACAGAGTGAGCATGCTCAGAGGATGGAGGAATT

CTATATTGAACAGAGAGACTTAGAGAAAAAGCTGGAGCAGGTGATGCAGCAGAAATGCACCTGTGACTCAACCTTGGAGAAGGACAGGGAGGCCGAGTAT

GCGGCTCAG - UNI18489 - CTGGCAGAACTGAGGCAAAGACTAGACCATGCTGAGGCCGACAGGCAGGAACTCCAAGATGAACTCAGACAGGAGCG

GGAGGCGAGACAGAAGCTGGAGATGATGATAAAGGAGCTGAAGCTGCAGATTGGCAAGTCGTCCAAGCCCTCCAAGGACTAAGAGCTGAAGAAGACACAC

CTGTGTGTGGTTGACAGGGCTTTGTGTTTGTCGCTTGCTTTGAAAATTGAATTCTAACATCTTATTTGCATGAAGGTAGCTAGGCATTCTGTTCATTTGT

ATGGCAGCAAAAGTGAAGATTATATATTAATACAAAATTTTCCATTTCCAAATGAATGAAAATGTATGCTTCTTTGTACTTTTCCAGTGGGCTTGGTAAT

AATAACCTGTGTAATTTGAGCCTGTGGTCAGTCTACCTGTATTTCTAACAGTTGCATACTTTCCAAAGCTGCAGTCTGTGGTGGAGAGTACCTGTGTCCA

TGGTATGCAATATTTCAGGCTCAGCTTAGATACAGAGGTAATGTTTATGATACAAAGCTA
Translation
MENLQSKFSLVQGSNKKLNGMEDDGSPPVKKMMTDIHANGKTLTKVKKEHLDDYGDASVEPDGEHAKRNRVSLPETLNLNPSLKHTLAQFHLSSQSSLGG

PAAFSARYSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTLLEGESISCFQVGGEKRLCLPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLH

ILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTF

VMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRNGKRIQSK - UNI8170 - - UNI19537 - TDTPSGMELPS

WYPVIKQEGDHVPQTHSFLHPS SYYLYMCDKVVAPNVSLTSAASQSKEATKAETSKSTSKQSEKPHESSQHQKTVSYPDVSLEEQEKMDLKTSRELYSC

LD - UNI25802 - DSSISNNSTSRKKSESAVCSLVRGTSKRDSEDSSPLLVRDGEDDKGKIMEDVMRTYVRQQEKLNSILQRKQQLQM EVEMLSSS

KAMKELTEEQQNLQKELESLQSEHAQRMEEFYIEQRDLEKKLEQVMQQKCTCDSTLEKDREAEYAAQ - UNI18489 - LAELRQRLDHAEADRQELQ

DELRQEREARQKLEMMIKELKLQIGKSSKPSKD
Transcript ENSMUST00000117728
Sequence
GGCGAGCGACGGCGACGGCGACGGCGGGCACAG - UNI8170 - - UNI12068 - - UNI16469 - ATCAATTAAAAGAAGAATGAGCTGTAAT

CCCTGAAGATAAAACTGGACAGCTTTTTCATTTAGTATATGTATATTTTTAATTATAAAAGTTCAGGTGGAGTCTTCAGTTTATCAGTACTGAGCAGCAG

ATCACCATTTTCAGGGACGATACCTGCCTCTTCTTTTTTGGTGTTCTTGGCAAAAATTAAACCCATTGCGTCATTGTAACTCATGTTTGGGTGTAGTTTC

AGGATACAGTCATGGTATAAACTTCCCACATGCTTTGCTTAAAAAACAAAACCAACCAAACTCAACCATTACACCGAACTTTGGACTTCTTGAATTGAGC

TTTATTTTAATATAAATACCTGAAGTGATTTTCTCAGAAGTGTGCTTACGATTATATTCTTATTTGTTATTAGAAGCAAACAAAACTGAGAAGTTTTGTA

GCATTTTCAATTATATCTTAAAGTACAGCTAAACCAAAACAGAGTTGTACAATCTATTGA - UNI8170 - - UNI14823 - ATTAGGAACTGAGA

ACAACATGCCAGTTGCAGACTTAATCGTTTAAAGCACCAGTGTGGCCATGGAAAACCTCCAGTCTAAGTTCTCCTTAGTTCAGGGTTCAAATAAAAAGCT

GAACGGCATGGAGGATGATGGCAGTCCTCCTGTGAAAAAAATGATGACCGACATTCATGCCAATGGGAAAACCCTGACCAAG - UNI8170 - GTTCT

TCCCGGCCCTCTTCTCATTCCTTCTGATAGCTCCACAGAGCTCACTCAGACTCTTTTGGAAGGGGAGTCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAG

AGACTCTGTTTGCCCCAAGTCTTAAACTCTGTCCTCCGAGAATTTTCACTCCAGCAGATAAACACAGTATGTGATGAGCTGTACATCTATTGTTCAAGGT

GTACTTCAGACCAGCTTCATATCTTAAAGGTCTTAGGGATACTCCCATTTAATGCTCCATCCTGTGGGCTGATCACGTTGACCGATGCACAAAGACTCTG

TAATGCTTTACTGCGGCCACGAACTTTTCCTCAAAATGGTAGCATACTTCCTGCTAAAAGCTCTCTGGCCCAGTTGAAGGAAACTGGCAGTGCCTTTGAA

GTGGAACATGAATGCTTGGGCAAATGTCAGGGTCTCTTTGCGCCTCAGTTTTATGTTCAGCCCGACGCTCCCTGTATCCAGTGCCTGGAGTGCTGTGGAA

TGTTTGCTCCCCAGACGTTCGTCATGCATTCGCACAGATCCCCTGACAAGAGAACTTGCCATTGGGGCTTTGAGTCAGCCAAGTGGCACTGTTACCTTCA

TGTGAACCAAAAATACCTAGGGACACCCGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAATGGAAAGAGAATC

CAATCAAAG - UNI8170 - - UNI19537 - ACAGATACACCATCGGGAATGGAATTGCCATCATGGTATCCTGTTATAAAACAGGAAGGTGACCA

TGTTCCCCAGACACATTCATTTTTACACCCCAG CTACTACCTGTACATGTGTGACAAAGTGGTTGCACCGAATGTGTCGCTCACATCTGCTGCGTCCCA

GTCTAAAGAGGCCACCAAGGCAGAGACAA - UNI25802 - ATTCATCAATCTCAAATAATTCTACAAGTAGAAAGAAATCTGAGTCTGCTGTGTGCA

GCTTAGTGAGAGGCACAAGCAAGCGTGATTCAGAAGATTCCTCTCCACTTCTGGTCAGAGATGGTGAAGACGACAAGGGGAAGATCATGGAAGACGTGAT

GAGAACCTATGTAAGACAGCAGGAGAAGCTGAACTCCATTCTGCAGAGGAAGCAGCAGCTGCAGATG GAGGTGGAGATGCTGAGCAGTTCAAAGGCGAT

GAAGGAGCTCACTGAAGAGCAGCAGAATCTACAGAAAGAGCTTGAGTCGTTACAGAGTGAGCATGCTCAGAGGATGGAGGAATTCTATATTGAACAGAGA

GACTTAGAGAAAAAGCTGGAGCAGGTGATGCAGCAGAAATGCACCTGTGACTCAACCTTGGAGAAGGACAGGGAGGCCGAGTATGCGGCTCAG - UNI1

8489 - CTGGCAGAACTGAGGCAAAGACTAGACCATGCTGAGGCCGACAGGCAGGAACTCCAAGATGAACTCAGACAGGAGCGGGAGGCGAGACAGAAG

CTGGAGATGATGATAAAGGAGCTGAAGCTGCAGATTGGCAAGTCGTCCAAGCCCTCCAAGGACTAAGAGCTGAAGAAGACACACCTGTGTGTGGTTGACA

GGGCTTTGTGTTTGTCGCTTGCTTTGAAAATTGAATTCTAACATCTTATTTGCATGAAGGTAGCTAGGCATTCTGTTCATTTGTATGGCAGCAAAAGTGA

AGATTATATATTAATACAAAATTTTCCATTTCCAAATGAATGAAAATGTATGCTTCTTTGTACTTTTCCAGTGGGCTTGGTAATAATAACCTGTGTAATT

TGAGCCTGTGGTCAGTCTACCTGTATTTCTAACAGTTGCATACTTTCCAAAGCTGCAGTCTGTGGTGGAGAGTACCTGTGTCCATGGTATGCAATATTTC

AGGCTCAGCTTAGATACAGAGGTAATGTTTATGATACAAAGCTATTTTGTATCCTTCTCATTACAGACTCTTGGGAAGCCGGTTGTTAATTTGTTCAGGT

TGTAGAGTGGGTTTCTTCTGTTTCCTCCTAGAGGAATTTGATTGATGGAATGATAGTACCACCTCCCTAACAAACAGTGTGTGTGTGTGGAGGGGAGGGG

CAGCCTTTGCTGTGCCCTGATGCTGCACACAAGAAGCAGTTGTAATTTGTCTTTCTGTTTAAGAGTGACTATCTCTAGATTGTGTGTGTGAGACTTCAGA

AAATTAAAATGATTTCTGAACTTTTCCTGTTAA
Translation
 - UNI8170 - - UNI12068 - - UNI16469 -  - UNI8170 - - UNI14823 - MENLQSKFSLVQGSNKKLNGMEDDGSPPVKKMMTD

IHANGKTLTK - UNI8170 - VLPGPLLIPSDSSTELTQTLLEGESISCFQVGGEKRLCLPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHIL

KVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVM

HSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRNGKRIQSK - UNI8170 - - UNI19537 - TDTPSGMELPSWY

PVIKQEGDHVPQTHSFLHPS SYYLYMCDKVVAPNVSLTSAASQSKEATKAETN - UNI25802 - NSSISNNSTSRKKSESAVCSLVRGTSKRDSED

SSPLLVRDGEDDKGKIMEDVMRTYVRQQEKLNSILQRKQQLQM EVEMLSSSKAMKELTEEQQNLQKELESLQSEHAQRMEEFYIEQRDLEKKLEQVMQQ

KCTCDSTLEKDREAEYAAQ - UNI18489 - LAELRQRLDHAEADRQELQDELRQEREARQKLEMMIKELKLQIGKSSKPSKD
Transcript ENSMUST00000118470
Sequence
GACGTCAGAGGCTGTGTGTAGCGATGTGTGTGGGGTTCGGAGCGGCGCCGGCACAGCGAAGGCGGCTGGCGAGCGACGGCGACGGCGACGGCGGGCACAG

 - UNI8170 - - UNI12068 - - UNI16469 - ATCAATTAAAAGAAGAATGAGCTGTAATCCCTGAAGATAAAACTGGACAGCTTTTTCATTT

AGTATATGTATATTTTTAATTATAAAAGTTCAGGTGGAGTCTTCAGTTTATCAGTACTGAGCAGCAGATCACCATTTTCAGGGACGATACCTGCCTCTTC

TTTTTTGGTGTTCTTGGCAAAAATTAAACCCATTGCGTCATTGTAACTCATGTTTGGGTGTAGTTTCAGGATACAGTCATGGTATAAACTTCCCACATGC

TTTGCTTAAAAAACAAAACCAACCAAACTCAACCATTACACCGAACTTTGGACTTCTTGAATTGAGCTTTATTTTAATATAAATACCTGAAGTGATTTTC

TCAGAAGTGTGCTTACGATTATATTCTTATTTGTTATTAGAAGCAAACAAAACTGAGAAGTTTTGTAGCATTTTCAATTATATCTTAAAGTACAGCTAAA

CCAAAACAGAGTTGTACAATCTATTGAGTAAGAAAATTCATCTTTGGAAAGTAAACATTTCTAAGTGAGTCATAAGTATTTGTATACATTCCCCTTTTCT

CTTCAGATTAGGAACTGAGAACAACATGCCAGTTGCAGACTTAATCGTTTAAAGCACCAGTGTGGCCATGGAAAACCTCCAGTCTAAGTTCTCCTTAGTT

CAGGGTTCAAATAAAAAGCTGAACGGCATGGAGGATGATGGCAGTCCTCCTGTGAAAAAAATGATGACCGACATTCATGCCAATGGGAAAACCCTGACCA

AGGTGAAGAAGGAGCACTTAGATGACTATGGAGATGCATCCGTGGAGCCGGATGGCGAGCACGCCAAGCGAAACCGTGTTTCTCTACCTGAAACTTTAAA

TTTAAACCCCAGTCTGAAACACACGCTGGCACAATTCCACTTAAGCAGTCAGAGCTCTTTGGGTGGACCAGCAGCATTTTCTGCTCGATATTCCCAGGAG

AGCATGTCACCGACTGTATTCCTGCCTCTTCCCTCTCCTCAGGTTCTTCCCGGCCCTCTTCTCATTCCTTCTGATAGCTCCACAGAGCTCACTCAGACTC

TTTTGGAAGGGGAGTCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAACTCTGTCCTCCGAGAATTTTCACTCCA

GCAGATAAACACAGTATGTGATGAGCTGTACATCTATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTCTTAGGGATACTCCCATTTAAT

GCTCCATCCTGTGGGCTGATCACGTTGACCGATGCACAAAGACTCTGTAATGCTTTACTGCGGCCACGAACTTTTCCTCAAAATGGTAGCATACTTCCTG

CTAAAAGCTCTCTGGCCCAGTTGAAGGAAACTGGCAGTGCCTTTGAAGTGGAACATGAATGCTTGGGCAAATGTCAGGGTCTCTTTGCGCCTCAGTTTTA

TGTTCAGCCCGACGCTCCCTGTATCCAGTGCCTGGAGTGCTGTGGAATGTTTGCTCCCCAGACGTTCGTCATGCATTCGCACAGATCCCCTGACAAGAGA

ACTTGCCATTGGGGCTTTGAGTCAGCCAAGTGGCACTGTTACCTTCATGTGAACCAAAAATACCTAGGGACACCCGAAGAAAAGAAACTGAAGATAATTT

TAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAATGGAAAGAGAATCCAATCAAAG - UNI8170 - - UNI19537 - ACAGATACACCATCGGGA

ATGGAATTGCCATCATGGTATCCTGTTATAAAACAGGAAGGTGACCATGTTCCCCAGACACATTCATTTTTACACCCCAG CTACTACCTGTACATGTGT

GACAAAGTGGTTGCACCGAATGTGTCGCTCACATCTGCTGCGTCCCAGTCTAAAGAGGCCACCAAGGCAGAGACAA - UNI25802 - ATTCATCAAT

CTCAAATAATTCTACAAGTAGAAAGAAATCTGAGTCTGCTGTGTGCAGCTTAGTGAGAGGCACAAGCAAGCGTGATTCAGAAGATTCCTCTCCACTTCTG

GTCAGAGATGGTGAAGACGACAAGGGGAAGATCATGGAAGACGTGATGAGAACCTATGTAAGACAGCAGGAGAAGCTGAACTCCATTCTGCAGAGGAAGC

AGCAGCTGCAGATG GAGGTGGAGATGCTGAGCAGTTCAAAGGCGATGAAGGAGCTCACTGAAGAGCAGCAGAATCTACAGAAAGAGCTTGAGTCGTTAC

AGAGTGAGCATGCTCAGAGGATGGAGGAATTCTATATTGAACAGAGAGACTTAGAGAAAAAGCTGGAGCAGGTGATGCAGCAGAAATGCACCTGTGACTC

AACCTTGGAGAAGGACAGGGAGGCCGAGTATGCGGCTCAG - UNI18489 - CTGGCAGAACTGAGGCAAAGACTAGACCATGCTGAGGCCGACAGGC

AGGAACTCCAAGATGAACTCAGACAGGAGCGGGAGGCGAGACAGAAGCTGGAGATGATGATAAAGGAGCTGAAGCTGCAGATTGGCAAGTCGTCCAAGCC

CTCCAAGGACTAAGAGCTGAAGAAGACACACCTGTGTGTGGTTGACAGGGCTTTGTGTTTGTCGCTTGCTTTGAAAATTGAATTCTAACATCTTATTTGC

ATGAAGGTAGCTAGGCATTCTGTTCATTTGTATGGCAGCAAAAGTGAAGATTATATATTAATACAAAATTTTCCATTTCCAAATGAATGAAAATGTATGC

TTCTTTGTACTTTTCCAGTGGGCTTGGTAATAATAACCTGTGTAATTTGAGCCTGTGGTCAGTCTACCTGTATTTCTAACAGTTGCATACTTTCCAAAGC

TGCAGTCTGTGGTGGAGAGTACCTGTGTCCATGGTATGCAATATTTCAGGCTCAGCTTAGATACAGAGGTAATGTTTATGATACAAAGCTATTTTGTATC

CTTCTCATTACAGACTCTTGGGAAGCCGGTTGTTAATTTGTTCAGGTTGTAGAGTGGGTTTCTTCTGTTTCCTCCTAGAGGAATTTGATTGATGGAATGA

TAGTACCACCTCCCTAACAAACAGTGTGTGTGTGTGGAGGGGAGGGGCAGCCTTTGCTGTGCCCTGATGCTGCACACAAGAAGCAGTTGTAATTTGTCTT

TCTGTTTAAGAGTGACTATCTCTAGATTGTGTGTGTGAGACTTCAGAAAATTAAAATGATTTCTGAACTTTTCCTGTTAACAGTGGTGTGGAAGTACTCA

TTCATGCTCACGAGGAAAATGGATTCCACTGATGTACGTTGGTTCCTATGTAACTCATAATCTTCTTGTACAGTTTTATATGTAGTCTTACAAAGGTCTT

ATGAAATTTATATAATGGATTTTTTTCTTTTAAATTATAAAATACTAAATATCTTGAAGATTATTTTGGACTTTTGTATGTTTAAATGTTATCTTAAAAC

TTGCACGAATGGACCATTATGACTCTTTAATCTTAAAATCAGGAATTTACAGTCAGCTAAGAATATGTGGTAGGTTAACAGTCCACAATTGAAGTATCTG

CTACTAGCAGGAATTTTAGATGACAAATGAATTCCGTGATTTGGGGAAGGGCAGCCTTTGCACTTTTCTTTGTTTTTGTTTTTTGCACATAAAGTCTGAT

GTTTTTATCACCGAATTTCACATTAGCAGATGCTTGGCTTGAAATTTGCTAGGGAAAATTTTCGGGGAACTTTGTAATTTTTTGGTTTTGTTCTGTTTGG

CCACCACTTTGCAGGGATCCTCTTGCCTCTGCCCACAGTACTGGGTCGACAGGCCTGAGCTCTGCCACCACCGGCCCTGTGCAGGTTTTAGGGATGTTTC

TGAAAGCAGCCCTGGCATTATCTTCTGTTGCGTGTGCCCCGGGCTGTCTCATAGCGCTACATGCACTTGAGATCTGTGCTTAGGAACAACTTGGAGTTTG

GCTGTCACTGTCCTCCATGCGGTAAGACATCGGAGCCCTGGGTTATCATACCTGCTTATGGTCATACTTTGTTTCATAATACTTGTTTAAAAGATACTTT

TCTACTTTCCAAACGGGAGTTTGTTTTCTAAATATATTGTGACCTTACTGTGGATTTATTCTACTCTGCTCTATAATTTAGTGTGGTGACTTCTGTAACC

TTGGGAGAAGCACGATAGGTGGCACAGGGACCATGTATGTCATTGTATTTAGATCTGGAGGGAGGAAGCCACGGGCACCTGTAAAGCCGCCTTAGCTTAG

TAGTCAGTCCATTGTACCCCAGCTTGGCTGCGTGGGAGGCACACTCAAGGACTCGCACCATTTATTTTTCTGACAGACTCAGAAGTGTTCTGCTTGGGTG

CTGCTTATAAGTGTGATTCTTCTAGTCTTGAAACTTGCCTCGTGACATTGTTGAGCGGTAGTCTTCACTTTCCAGAAGATGAAATGATGTGCCATCGTTT

TCTGTCTAAACTTCCTTACAATTTTTAATCAACTGTAAATAGCATATCTACTGCTGTTGAAAGTAACTTTAATTTACATTGCATCATATAGCTTGAAAAC

CACCTTTGACATTCTGTAATACCCCACAAGTGACCTCTGCTAAAATATCCAGATGAAGCTTACTTCGTGCATGCTCATTCTGTGTGCTGGTTGCTCTCGT

AAGGTTGGCTTTGGTGTGAGGTCTCGTGTGCTATGCCAAGTTCACTAGGCAAGCAGATTTTCCTTCAGAGTCCATACTCTGTTTAGGGAGGAATGAGACC

ATTTATTCTGAGAAACTATGTTTAGGAGTGGAAGAAACACAGCGTTAGCTTTCATACTGAGCAAAGACTGACGTTGCTATGGGTGGTCTCTCTCTGTGGT

CCAGACTGAGGGCTTTGCACCAAGTACTTAAGTGTGGAAGCTCCTGTGCCATCAAGGAGGAGTTTAAACAAACCACCTGCCAATCACAGCTGAGACTGAG

CACCGAAAGATTCTACCAACTTAGGTTTGGCTCGGGCTTTAACAGTTTTGAAGTATAGTCTTTAGCTTGAATCTCTTGTGTTTTTTGAAGATAAGGATGT

TTTATGCTTCTTGAGCTAATTTTATAACATATTTAATATATAACCTGTTTATATGTAAAATCTTTTGTACAGGGGTGGGAAGGAGTAATGAAAAACCTGA

TTTGTACATAGTGAAGTTTATGTGCAGACCGAAGTCAGTGAACCAGTAACTGAGGTGTTTGCAGGCTCTCCACATCCTTCAGAGTCCGTGAAGCGCCCAG

TCTGTGTGTCTCTGGTTCCTGTCTGCAGAAAAGCAAAATGAAAAGGAAGCACAAGTAATAGGAACTGTGCCCGAGGTATTTCCCTAGCAGGAGCTGCAAA

GCTGGTCCTGGGGGTCTGCATCCCCTCTGGAAGGCCTGCCCCACATGCCGTGCTCTGAGTGAGGAGGGAAGGATGTGTGTTTTTGTTTGTTATGCATTTA

CTCTTTAGGGCAGGACGTTACAAACTGATGGTAAATTGTGTTCATGCTATGTACATGTGCTCCTGAACTTGGATCTACTTGTTAATGGTTCCATGGAAGC

AATCAGCAGTGTGTGACATGAACTGCTGCATTATGTATTTACTTGTGGAACTGAGATATGTAAACAGAGCTTACCTTTTTTTTTTTTTTTTTTTTTTCTA

GTGTAAAATACTTAAGCATTTCCACTATTGGAAGAAAAAACATATATGGACATTTTGTATTGTATCTTGTTTAAAAGGACAGTCTTTTTTAATCTTCCCA

CTTAAATGGCTTTTAAAATATATAATACAATTTGAAGCTTGTTTAGAAATAGGATTAAATGTCTTATATAGTGCTACAGTTTTGGAATTAGAAAGTGATC

AACTATAAAACATTTTAAAATTAAGCCCAGAAAACAAAATAGTGTTTAAAGTTAGTTTAGTATAAAAGAAATTTATAAGATTTTTTTCTTCAATATAAGA

TACCTCACTTGAGAATAAAGAAAGCACAGCACATTTAAAGTAATTCTCATGAAAACCCCATTAAAATAATTGCTAAACCTAGGACATCTTTTGAGTTGTT

AGAGTTTGGGATAAATGTAGTCACCATTAGTTTCTCTGCTGGAAGGACTTACCTTGGTAATTTTAAGGCAGTGTAATAGTTCAATTATTCCTCAGTTTCT

AACCTGTGAAGGCAGTAAGTGAATGGTCCCTTCTGCAACTACTGAAACAAATTAGCTACATTGAGCATAATTGATAATTTTGCCAATGCATATAGTTTTA

TGATTAAAATTGCTGTGGTTGGTTGCATTACATGACACACAAAACTGTCCTCTACCTCACGTGAAATAAATATTTTATATGGTTTTACTAAAAAAAAAAG

ACTCATCTATCTGGTTACTTAGTTTACAAATTTTGGATTATATTTATTGAAACATGACATACTGTGCTCTTGGCTTATACCTCAATTGTATTTTGAGATG

TTTGCCATTTTCATGCCTTGTACATAACTTGTATAGATTGGATGATATTCCCAATAAAAACTTTTAATGCCAATGAA
Translation
 - UNI8170 - - UNI12068 - - UNI16469 - MENLQSKFSLVQGSNKKLNGMEDDGSPPVKKMMTDIHANGKTLTKVKKEHLDDYGDASVEP

DGEHAKRNRVSLPETLNLNPSLKHTLAQFHLSSQSSLGGPAAFSARYSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTLLEGESISCFQVGGEKR

LCLPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEV

EHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRNGKRIQ

SK - UNI8170 - - UNI19537 - TDTPSGMELPSWYPVIKQEGDHVPQTHSFLHPS SYYLYMCDKVVAPNVSLTSAASQSKEATKAETN - UN

I25802 - NSSISNNSTSRKKSESAVCSLVRGTSKRDSEDSSPLLVRDGEDDKGKIMEDVMRTYVRQQEKLNSILQRKQQLQM EVEMLSSSKAMKELT

EEQQNLQKELESLQSEHAQRMEEFYIEQRDLEKKLEQVMQQKCTCDSTLEKDREAEYAAQ - UNI18489 - LAELRQRLDHAEADRQELQDELRQER

EARQKLEMMIKELKLQIGKSSKPSKD
Transcript ENSMUST00000029194
Sequence
GTCAGAGGCTGTGTGTAGCGATGTGTGTGGGGTTCGGAGCGGCGCCGGCACAGCGAAGGCGGCTGGCGAGCGACGGCGACGGCGACGGCGGGCACAG - 

UNI8170 - - UNI12068 - - UNI16469 - ATCAATTAAAAGAAGAATGAGCTGTAATCCCTGAAGATAAAACTGGACAGCTTTTTCATTTAGT

ATATGTATATTTTTAATTATAAAAGTTCAGGTGGAGTCTTCAGTTTATCAGTACTGAGCAGCAGATCACCATTTTCAGGGACGATACCTGCCTCTTCTTT

TTTGGTGTTCTTGGCAAAAATTAAACCCATTGCGTCATTGTAACTCATGTTTGGGTGTAGTTTCAGGATACAGTCATGGTATAAACTTCCCACATGCTTT

GCTTAAAAAACAAAACCAACCAAACTCAACCATTACACCGAACTTTGGACTTCTTGAATTGAGCTTTATTTTAATATAAATACCTGAAGTGATTTTCTCA

GAAGTGTGCTTACGATTATATTCTTATTTGTTATTAGAAGCAAACAAAACTGAGAAGTTTTGTAGCATTTTCAATTATATCTTAAAGTACAGCTAAACCA

AAACAGAGTTGTACAATCTATTGAGTAAGAAAATTCATCTTTGGAAAGTAAACATTTCTAAGTGAGTCATAAGTATTTGTATACATTCCCCTTTTCTCTT

CAGATTAGGAACTGAGAACAACATGCCAGTTGCAGACTTAATCGTTTAAAGCACCAGTGTGGCCATGGAAAACCTCCAGTCTAAGTTCTCCTTAGTTCAG

GGTTCAAATAAAAAGCTGAACGGCATGGAGGATGATGGCAGTCCTCCTGTGAAAAAAATGATGACCGACATTCATGCCAATGGGAAAACCCTGACCAAGG

TGAAGAAGGAGCACTTAGATGACTATGGAGATGCATCCGTGGAGCCGGATGGCGAGCACGCCAAGCGAAACCGTGTTTCTCTACCTGAAACTTTAAATTT

AAACCCCAGTCTGAAACACACGCTGGCACAATTCCACTTAAGCAGTCAGAGCTCTTTGGGTGGACCAGCAGCATTTTCTGCTCGATATTCCCAGGAGAGC

ATGTCACCGACTGTATTCCTGCCTCTTCCCTCTCCTCAGGTTCTTCCCGGCCCTCTTCTCATTCCTTCTGATAGCTCCACAGAGCTCACTCAGACTCTTT

TGGAAGGGGAGTCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAACTCTGTCCTCCGAGAATTTTCACTCCAGCA

GATAAACACAGTATGTGATGAGCTGTACATCTATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTCTTAGGGATACTCCCATTTAATGCT

CCATCCTGTGGGCTGATCACGTTGACCGATGCACAAAGACTCTGTAATGCTTTACTGCGGCCACGAACTTTTCCTCAAAATGGTAGCATACTTCCTGCTA

AAAGCTCTCTGGCCCAGTTGAAGGAAACTGGCAGTGCCTTTGAAGTGGAACATGAATGCTTGGGCAAATGTCAGGGTCTCTTTGCGCCTCAGTTTTATGT

TCAGCCCGACGCTCCCTGTATCCAGTGCCTGGAGTGCTGTGGAATGTTTGCTCCCCAGACGTTCGTCATGCATTCGCACAGATCCCCTGACAAGAGAACT

TGCCATTGGGGCTTTGAGTCAGCCAAGTGGCACTGTTACCTTCATGTGAACCAAAAATACCTAGGGACACCCGAAGAAAAGAAACTGAAGATAATTTTAG

AAGAAATGAAGGAGAAGTTTAGCATGAGAAATGGAAAGAGAATCCAATCAAAG - UNI8170 - - UNI19537 - ACAGATACACCATCGGGAATG

GAATTGCCATCATGGTATCCTGTTATAAAACAGGAAGGTGACCATGTTCCCCAGACACATTCATTTTTACACCCCAG CTACTACCTGTACATGTGTGAC

AAAGTGGTTGCACCGAATGTGTCGCTCACATCTGCTGCGTCCCAGTCTAAAGAGGCCACCAAGGCAGAGACAAGTAAGTCCACCTCCAAACAGTCAGAAA

AGCCTCATGAGAGTAGTCAGCATCAAAAAACAGTGTCTTACCCAGACGTCTCACTTGAGGAGCAGGAGAAAATGGATTTAAAAACCAGTAGAGAATTATA

CAGTTGTTTAG - UNI25802 - ATTCATCAATCTCAAATAATTCTACAAGTAGAAAGAAATCTGAGTCTGCTGTGTGCAGCTTAGTGAGAGGCACAA

GCAAGCGTGATTCAGAAGATTCCTCTCCACTTCTGGTCAGAGATGGTGAAGACGACAAGGGGAAGATCATGGAAGACGTGATGAGAACCTATGTAAGACA

GCAGGAGAAGCTGAACTCCATTCTGCAGAGGAAGCAGCAGCTGCAGATG GAGGTGGAGATGCTGAGCAGTTCAAAGGCGATGAAGGAGCTCACTGAAGA

GCAGCAGAATCTACAGAAAGAGCTTGAGTCGTTACAGAGTGAGCATGCTCAGAGGATGGAGGAATTCTATATTGAACAGAGAGACTTAGAGAAAAAGCTG

GAGCAGGTGATGCAGCAGAAATGCACCTGTGACTCAACCTTGGAGAAGGACAGGGAGGCCGAGTATGCGGCTCAG - UNI18489 - CTGGCAGAACT

GAGGCAAAGACTAGACCATGCTGAGGCCGACAGGCAGGAACTCCAAGATGAACTCAGACAGGAGCGGGAGGCGAGACAGAAGCTGGAGATGATGATAAAG

GAGCTGAAGCTGCAGATTGGCAAGTCGTCCAAGCCCTCCAAGGACTAAGAGCTGAAGAAGACACACCTGTGTGTGGTTGACAGGGCTTTGTGTTTGTCGC

TTGCTTTGAAAATTGAATTCTAACATCTTATTTGCATGAAGGTAGCTAGGCATTCTGTTCATTTGTATGGCAGCAAAAGTGAAGATTATATATTAATACA

AAATTTTCCATTTCCAAATGAATGAAAATGTATGCTTCTTTGTACTTTTCCAGTGGGCTTGGTAATAATAACCTGTGTAATTTGAGCCTGTGGTCAGTCT

ACCTGTATTTCTAACAGTTGCATACTTTCCAAAGCTGCAGTCTGTGGTGGAGAGTACCTGTGTCCATGGTATGCAATATTTCAGGCTCAGCTTAGATACA

GAGGTAATGTTTATGATACAAAGCTATTTTGTATCCTTCTCATTACAGACTCTTGGGAAGCCGGTTGTTAATTTGTTCAGGTTGTAGAGTGGGTTTCTTC

TGTTTCCTCCTAGAGGAATTTGATTGATGGAATGATAGTACCACCTCCCTAACAAACAGTGTGTGTGTGTGGAGGGGAGGGGCAGCCTTTGCTGTGCCCT

GATGCTGCACACAAGAAGCAGTTGTAATTTGTCTTTCTGTTTAAGAGTGACTATCTCTAGATTGTGTGTGTGAGACTTCAGAAAATTAAAATGATTTCTG

AACTTTTCCTGTTAACAGTGGTGTGGAAGTACTCATTCATGCTCACGAGGAAAATGGATTCCACTGATGTACGTTGGTTCCTATGTAACTCATAATCTTC

TTGTACAGTTTTATATGTAGTCTTACAAAGGTCTTATGAAATTTATATAATGGATTTTTTTCTTTTAAATTATAAAATACTAAATATCTTGAAGATTATT

TTGGACTTTTGTATGTTTAAATGTTATCTTAAAACTTGCACGAATGGACCATTATGACTCTTTAATCTTAAAATCAGGAATTTACAGTCAGCTAAGAATA

TGTGGTAGGTTAACAGTCCACAATTGAAGTATCTGCTACTAGCAGGAATTTTAGATGACAAATGAATTCCGTGATTTGGGGAAGGGCAGCCTTTGCACTT

TTCTTTGTTTTTGTTTTTTGCACATAAAGTCTGATGTTTTTATCACCGAATTTCACATTAGCAGATGCTTGGCTTGAAATTTGCTAGGGAAAATTTTCGG

GGAACTTTGTAATTTTTTGGTTTTGTTCTGTTTGGCCACCACTTTGCAGGGATCCTCTTGCCTCTGCCCACAGTACTGGGTCGACAGGCCTGAGCTCTGC

CACCACCGGCCCTGTGCAGGTTTTAGGGATGTTTCTGAAAGCAGCCCTGGCATTATCTTCTGTTGCGTGTGCCCCGGGCTGTCTCATAGCGCTACATGCA

CTTGAGATCTGTGCTTAGGAACAACTTGGAGTTTGGCTGTCACTGTCCTCCATGCGGTAAGACATCGGAGCCCTGGGTTATCATACCTGCTTATGGTCAT

ACTTTGTTTCATAATACTTGTTTAAAAGATACTTTTCTACTTTCCAAACGGGAGTTTGTTTTCTAAATATATTGTGACCTTACTGTGGATTTATTCTACT

CTGCTCTATAATTTAGTGTGGTGACTTCTGTAACCTTGGGAGAAGCACGATAGGTGGCACAGGGACCATGTATGTCATTGTATTTAGATCTGGAGGGAGG

AAGCCACGGGCACCTGTAAAGCCGCCTTAGCTTAGTAGTCAGTCCATTGTACCCCAGCTTGGCTGCGTGGGAGGCACACTCAAGGACTCGCACCATTTAT

TTTTCTGACAGACTCAGAAGTGTTCTGCTTGGGTGCTGCTTATAAGTGTGATTCTTCTAGTCTTGAAACTTGCCTCGTGACATTGTTGAGCGGTAGTCTT

CACTTTCCAGAAGATGAAATGATGTGCCATCGTTTTCTGTCTAAACTTCCTTACAATTTTTAATCAACTGTAAATAGCATATCTACTGCTGTTGAAAGTA

ACTTTAATTTACATTGCATCATATAGCTTGAAAACCACCTTTGACATTCTGTAATACCCCACAAGTGACCTCTGCTAAAATATCCAGATGAAGCTTACTT

CGTGCATGCTCATTCTGTGTGCTGGTTGCTCTCGTAAGGTTGGCTTTGGTGTGAGGTCTCGTGTGCTATGCCAAGTTCACTAGGCAAGCAGATTTTCCTT

CAGAGTCCATACTCTGTTTAGGGAGGAATGAGACCATTTATTCTGAGAAACTATGTTTAGGAGTGGAAGAAACACAGCGTTAGCTTTCATACTGAGCAAA

GACTGACGTTGCTATGGGTGGTCTCTCTCTGTGGTCCAGACTGAGGGCTTTGCACCAAGTACTTAAGTGTGGAAGCTCCTGTGCCATCAAGGAGGAGTTT

AAACAAACCACCTGCCAATCACAGCTGAGACTGAGCACCGAAAGATTCTACCAACTTAGGTTTGGCTCGGGCTTTAACAGTTTTGAAGTATAGTCTTTAG

CTTGAATCTCTTGTGTTTTTTGAAGATAAGGATGTTTTATGCTTCTTGAGCTAATTTTATAACATATTTAATATATAACCTGTTTATATGTAAAATCTTT

TGTACAGGGGTGGGAAGGAGTAATGAAAAACCTGATTTGTACATAGTGAAGTTTATGTGCAGACCGAAGTCAGTGAACCAGTAACTGAGGTGTTTGCAGG

CTCTCCACATCCTTCAGAGTCCGTGAAGCGCCCAGTCTGTGTGTCTCTGGTTCCTGTCTGCAGAAAAGCAAAATGAAAAGGAAGCACAAGTAATAGGAAC

TGTGCCCGAGGTATTTCCCTAGCAGGAGCTGCAAAGCTGGTCCTGGGGGTCTGCATCCCCTCTGGAAGGCCTGCCCCACATGCCGTGCTCTGAGTGAGGA

GGGAAGGATGTGTGTTTTTGTTTGTTATGCATTTACTCTTTAGGGCAGGACGTTACAAACTGATGGTAAATTGTGTTCATGCTATGTACATGTGCTCCTG

AACTTGGATCTACTTGTTAATGGTTCCATGGAAGCAATCAGCAGTGTGTGACATGAACTGCTGCATTATGTATTTACTTGTGGAACTGAGATATGTAAAC

AGAGCTTACCTTTTTTTTTTTTTTTTTTTTTTCTAGTGTAAAATACTTAAGCATTTCCACTATTGGAAGAAAAAACATATATGGACATTTTGTATTGTAT

CTTGTTTAAAAGGACAGTCTTTTTTAATCTTCCCACTTAAATGGCTTTTAAAATATATAATACAATTTGAAGCTTGTTTAGAAATAGGATTAAATGTCTT

ATATAGTGCTACAGTTTTGGAATTAGAAAGTGATCAACTATAAAACATTTTAAAATTAAGCCCAGAAAACAAAATAGTGTTTAAAGTTAGTTTAGTATAA

AAGAAATTTATAAGATTTTTTTCTTCAATATAAGATACCTCACTTGAGAATAAAGAAAGCACAGCACATTTAAAGTAATTCTCATGAAAACCCCATTAAA

ATAATTGCTAAACCTAGGACATCTTTTGAGTTGTTAGAGTTTGGGATAAATGTAGTCACCATTAGTTTCTCTGCTGGAAGGACTTACCTTGGTAATTTTA

AGGCAGTGTAATAGTTCAATTATTCCTCAGTTTCTAACCTGTGAAGGCAGTAAGTGAATGGTCCCTTCTGCAACTACTGAAACAAATTAGCTACATTGAG

CATAATTGATAATTTTGCCAATGCATATAGTTTTATGATTAAAATTGCTGTGGTTGGTTGCATTACATGACACACAAAACTGTCCTCTACCTCACGTGAA

ATAAATATTTTATATGGTTTTACTAAAAAAAAAAGACTCATCTATCTGGTTACTTAGTTTACAAATTTTGGATTATATTTATTGAAACATGACATACTGT

GCTCTTGGCTTATACCTCAATTGTATTTTGAGATGTTTGCCATTTTCATGCCTTGTACATAACTTGTATAGATTGGATGATATTCCCAATAAAAACTTTT

AATGCCAATGAA
Translation
 - UNI8170 - - UNI12068 - - UNI16469 - MENLQSKFSLVQGSNKKLNGMEDDGSPPVKKMMTDIHANGKTLTKVKKEHLDDYGDASVEP

DGEHAKRNRVSLPETLNLNPSLKHTLAQFHLSSQSSLGGPAAFSARYSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTLLEGESISCFQVGGEKR

LCLPQVLNSVLREFSLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSILPAKSSLAQLKETGSAFEV

EHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRNGKRIQ

SK - UNI8170 - - UNI19537 - TDTPSGMELPSWYPVIKQEGDHVPQTHSFLHPS SYYLYMCDKVVAPNVSLTSAASQSKEATKAETSKSTSK

QSEKPHESSQHQKTVSYPDVSLEEQEKMDLKTSRELYSCLD - UNI25802 - DSSISNNSTSRKKSESAVCSLVRGTSKRDSEDSSPLLVRDGEDDK

GKIMEDVMRTYVRQQEKLNSILQRKQQLQM EVEMLSSSKAMKELTEEQQNLQKELESLQSEHAQRMEEFYIEQRDLEKKLEQVMQQKCTCDSTLEKDRE

AEYAAQ - UNI18489 - LAELRQRLDHAEADRQELQDELRQEREARQKLEMMIKELKLQIGKSSKPSKD

For any suggestions or comments, please send an email to unitrap@crg.es