Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027665 (Pik3ca)
Chromosomal location
Chr 3: 32296593 - 32365029 (+)
Description
phosphatidylinositol 3-kinase, catalytic, alpha polypeptide Gene [Source:MGI (curated);Acc:Pik3ca-001]
RefSeq_dna
NM_008839 
RefSeq_peptide
NP_032865.1 
UniGene
Mm.393204 Mm.462541 Mm.474860 Mm.260521 
MGI
MGI:1206581 
Uniprot/SWISSPROT
P42337 
Uniprot/SPTREMBL
Q0VGQ5 
Human Ortholog
ENSG00000121879 (PIK3CA)
Omim 114480 - BREAST CANCER  114500 - COLORECTAL CANCER  114550 - HEPATOCELLULAR CARCINOMA  604370 - BREAST-OVARIAN CANCER, FAMILIAL, SUSCEPTIBILITY TO, 1  
UniTrap UNI36819
Vector Insertion
Chr 3: 32296723 - 32335297
Public Clones (sanger) 5SD185H07 (ggtc) IST11388H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17136
Vector Insertion
Chr 3: 32335072 - 32335480
Public Clones not available
Private Clones OST448712 (lexicon) OST377501 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108242
Sequence
TCTCCATCAGCTTCTGCAAGACGAAACTTCTTACATTTTC - UNI17136 - GTTTTGTTATTGGCATGCCAGTGTGTGAATTTGATATGGTTAAAGA

TCCAGAAGTCCAAGACTTTCGAAGGAACATTCTGAATGTTTGCAAAGAAGCTGTGGACCTGCGGGATCTCAACTCGCCTCATAGCAGAGCAATGTATGTC

TACCCTCCAAATGTCGAGTCTTCCCCAGAACTGCCAAAGCACATCTACAACAAGTTAGATAAAG GACAAATCATAGTGGTGATTTGGGTAATAGTCTCT

CCAAACAACGACAAGCAGAAGTACACTCTGAAGATCAATCATGACTGTGTGCCAGAGCAAGTCATTGCTGAAGCCATCAGGAAAAAGACTCGGAGCATGT

TGTTGTCCTCTGAGCAGCTGAAACTCTGTGTCTTAGAATATCAGGGCAAGTATATTCTGAAAGTGTGTGGCTGTGACGAATACTTCCTGGAAAAGTACCC

TCTGAGTCAGTACAAG TACATAAGAAGCTGTATAATGCTGGGGAGGATGCCCAACTTGATGCTGATGGCCAAAGAAAGCCTATACTCTCAGCTGCCGAT

TGATAGCTTCACCATGCCGTCATACTCCAGGCGCATCTCCACAGCCACACCCTACATGAATGGAGAGACATCTACGAAATCCCTCTGGGTCATAAATAGT

GCGCTCAGAATAAAAATTCTTTGTGCAACCTATGTAAATGTAAATATTCGAGACATTGATAAG ATCTATGTTCGAACAGGTATCTACCATGGAGGAGAA

CCCTTATGTGACAATGTGAACACTCAAAGAGTACCTTGTTCCAATCCTAG GTGGAATGAATGGCTGAATTATGATATATACATTCCTGATCTTCCTCGT

GCTGCGCGCCTTTGCCTTTCAATCTGCTCTGTTAAAGGCCGAAAGGGTGCTAAGGAG GAGCACTGTCCGTTGGCCTGGGGAAACATAAACTTGTTTGAT

TATACAGACACCCTAGTGTCCGGGAAAATGGCTTTGAATCTCTGGCCTGTACCGCATGGGTTAGAAGATCTGCTGAACCCTATTGGTGTTACTGGGTCAA

ATCCAAATAAA GAAACTCCATGCTTAGAGTTGGAGTTTGATTGGTTCAGCAGTGTGGTGAAGTTTCCAGACATGTCTGTGATCGAAGAACATGCCAATT

GGTCCGTGTCCCGAGAAGCTGGATTCAGTTACTCCCATACAGGACTG AGTAACAGACTAGCCAGAGACAATGAGTTAAGAGAAAATGACAAGGAACAGC

TCCGAGCACTTTGCACCCGGGACCCACTATCTGAAATCACTGAACAAGAGAAAGACTTCCTATGGAGCCACAG ACACTACTGCGTAACTATTCCTGAAA

TCCTACCCAAATTGCTTCTGTCTGTCAAGTGGAATTCCAGAGACGAAGTGGCCCAG ATGTACTGCTTAGTAAAAGATTGGCCTCCAATCAAACCAGAGC

AAGCCATGGAACTCCTGGACTGTAACTATCCAGATCCTATGGTTCGGAGTTTTGCTGTTCGGTGCTTAGAAAAATATTTAACAGATGACAAACTTTCTCA

GTACCTCATTCAACTTGTACAG GTCTTAAAATATGAACAGTATTTGGATAACCTGCTTGTGAGATTTTTACTCAAGAAAGCATTGACAAATCAAAGGAT

TGGCCATTTTTTCTTTTGGCATTTAAA ATCTGAGATGCACAATAAGACTGTCAGTCAGAGGTTTGGCCTGCTATTGGAGTCCTACTGCCGTGCCTGTGG

GATGTATCTGAAGCACCTGAACAGACAAGTAGAGGCCATGGAGAAGCTCATCAACCTAACGGACATCCTTAAGCAGGAGAAGAAGGATGAGACACAAAAG

 GTACAGATGAAGTTTTTGGTTGAACAGATGAGACAGCCAGACTTCATGGATGCTTTGCAGGGTTTTCTGTCCCCTCTGAATCCTGCTCACCAACTAGGA

AACCTCAG GCTTGAAGAGTGTCGAATTATGTCCTCTGCAAAAAGGCCACTGTGGTTGAATTGGGAGAACCCAGACATCATGTCAGAGCTACTGTTTCAG

AACAATGAGATCATCTTTAAAAATGGCGACG ACTTACGGCAAGATATGTTAACCCTTCAGATCATCCGAATCATGGAGAACATCTGGCAAAACCAAGGC

CTTGACCTTCG CATGCTACCTTATGGCTGTCTATCCATTGGGGACTGTGTGGGTCTCATCGAGGTGGTGAGAAACTCTCACACCATCATGCAAATCCAG

TGCAAAGGAGGCCTGAAGGGGGCGCTGCAGTTCAACAGCCACACACTGCATCAATGGCTCAAGGACAAGAACAAGGGCGAGAT ATATGATGCAGCCATT

GACCTGTTCACTCGGTCCTGCGCTGGGTACTGCGTGGCAACCTTTATCTTGGGAATTGGAGACCGGCACAACAGCAACATCATGGTGAAAGATGACGGAC

AG CTGTTTCATATAGATTTTGGGCACTTTTTGGATCACAAGAAGAAAAAATTTGGCTATAAGCGGGAACGTGTGCCATTTGTGTTGACACAGGATTTCT

TGATTGTGATTAGTAAGGGAGCACAAGAGTACACCAAGACCAGAGAGTTTGAGAG GTTTCAGGAGATGTGTTACAAGGCTTACCTAGCAATTCGGCAGC

ATGCCAATCTCTTCATCAACCTTTTTTCAATGATGCTTGGCTCTGGAATGCCAGAACTACAATCTTTTGATGACATTGCATATATCCGAAAGACTCTAGC

CTTGGACAAAACTGAGCAAGAAGCTTTGGAATATTTCACAAAGCAAATGAATGATGCACATCATGGTGGATGGACGACAAAAATGGATTGGATCTTCCAC

ACCATCAAGCAGCATGCTTTGAACTGAGATGGGAGCTGGGACTGCGAGCTGGCTCCCGGCTTCTCCACTGCATGGCAGTGAGTGGCAGCAGGCAGGCAGT

GGCATGGGATGGCACAGTCAGGAACAACATTAGGACTTGAGCAAGAACATAAACAACGTGCTCTATAATTGAAACACTGTACACGCAAGCAGGGTTTGAT

AGCACTAAACTAGTTTATTTCAAAATCCAGCTTTAGAATAACGAGCAATTTCATGTTATGCCTTAAGTCCAAAAAAGGTAAACTTTGAAGATTGTTTGTA

TCTTTTTTTAAAAAAACAAAACAAAACAAAAATCCCCAAAATACATACAAATGATGGAGACAAAACTAGAATGCTGTTGTTTGTCTGCCAGTGTTCTGTC

TAACACGTGGACACGCCCAAGGCTGTGACTGCTATAGGTCTGAGTAAGCTAAAGCTTATATTAAGTTACATGAATTGGAGAAGAAGGAAAATTCTGATTT

TCCCATTGCTGTTCAGACTTAACGATTTGAAGTGGGGATTTTGATCCCTGCTTAATGAGGAACAACACTTGGGGTGAAGGGACTCGCTTTTTGCTTTGAA

CAAACAACACTTTGATGGACTTGGGGTCTCACCTGCGGTTTTGAAAGCAGTCACAATACTTGCAGACAGCTGCGTTTTTGTTGGGTGTTGTTTTTTGTTG

TTTTTTTCTCTGGACAGTATTTACAAGGATCTGACTTATTTCCTAGGGAAATTCTGGGCTGGCATCAAGTATAGCAGTAAGGGCAGAGGAGAGGCCGCAG

GGAGCCCCTGTTCCTGACCTGTACAGTGTTCACTTTCAGCTGATTGTTTCTCCTTTTGCAATTGAACTGAATACTTTTTTTTCATGCATGTTTTCCAGAA

AATAGAAGTGAGTATTAATGTTATTAAAAAGATTATTTTTTTTTATTAAAGGCTATTTATATTATAGAAACTATCATTAATATATATTCTTTATTTACAT

AATCTGTCCCATAGTCATGCATTGTTTTGCACCCCAAATTTTTTATCGTTGGTAACAGCATGGTTAGCTTTTCTCTCGGTCTGTAGATGAGGCTCAGGCA

CTATTCCATTTATCCAATACCCGTGTATGACTCCTTAAGGAACAGATTGAATCGCACACGCTTTCCTGCCGCTGCTGGCCGTTTTTTACACGACGCCCTC

ATCCATTCCTCCGTAGTTGAGACAGCACAATCACATGAAACCCGTTACTAAAATGAATACAAAACCGACTATCATCCTGACTCTTAATCCTTCTGCAGAG

GTCTAGTCATGAGTGACTCTTTACATTATGAGAGACTGGAAACCATGAATTTTTTACCTTCGTAAGCTACGTATCCGTACTTCAATGATAAAAGTAGGAC

ATTAACCCATTTTACTATCATGTCCCAATTCCAAGTGGTGAGGTCTCACTCCAGTGTCATTAAATCCCATTCAGGCACGGTGCATTAGTGAGCATTCTGA

AATGCATCCATCTAAGATGTAGGGCTAATGTTAGTGGTCGCTCTAGATTTCTACTCAGTGTTTGAATGATTCATGTCCTAGAAAATAGCTTTAGCAGATA

CTCAGATGCCACACCAAAAAAAGAAGAAAAAAAGAAAAAAAAAAGAATAAATAAAAAGGAAAAAAAAAAGAAAAACTGTGCAATAATCTCCTGACAGTTC

CTAGCTCAGGCGTTCCTGGGGAGCATCGTTATGAAGAGCGCACGCTGTACACGCTAGAAAACAGAATCCCTGTAATACAGTGCTCACCTTGAGGCCAGAC

ACCTATATAGACGTTTTGAATAGTGAACAGGGGACTCTAATAGAAATACTCTTAATATCTGCCTATTTTTAGAACCCTTAAAGGGCATAATTATTGAAGA

TTTAGGTACTTCACTAAAGCATGTATATATTATTGCCAACAAGAAAAATAAACCTGAAGATTAGGGGAACTTGGTTCTGTAAACTGTCTTGGAATAGTTA

AGCAGAATTTAAGCTCTGTTTTATGCAGAAAACCAGATAGATTCTTTTGCAGATATAGAAAACTTCCTAACTTATTTAAACTTGGCATTTAACACTTTGT

GTTACTTAGATATACAGTTGCTAGGTACTAACATCCCATTCTTCTCTATATCAGGGATTATTACAGTCAAACTCAGTGACATGGTACAAATCTACAACTT

TGATGGTGGGAACTGAAGAATTACAGAGAACTGTGTTTTCCCGAGTGCCAAAAGAAACAAAAACAAAACAAAACAAACAAACCCCACAAAAAAAAGAAAA

AAAAAAAAAAGCCGCGAGCCTCCTTGCACAAAATTGATAGGTTTTTTTTTGTGTGTATGTGTGTGTTTGTGTGTGTGTATGTTTAACATTAGTCCATCAG

TTGCCGTAGTATCACCTCCCAGGTCTCTGCACAATTAAAACACAGCCACATAGCTTATTTTGTCATTTACAACCACATTGATTTTATTTGAAAGAAAGTC

TATAGTCTGTGAAGGGTATAAGTAAAGAAAGGAGAACTGGTTGTATTCAAAAAGGCAAAAGCCAAACTTGAATTGCAGCTGGGGTGATCAATATCTGCTT

CCAGAGAGCAATAATGTGCCACTTACTCCCAGGTGCTTCAGTACCAGAAAGTGCTGTGGGACTCGGTCACCTCTGTAGATGACCGTCCTTGTCAGTGAAT

GACTATTGTGGAAATGACTTGGGCTCCATAGTTTCACTAAGTCACTTGAGGATGTCTCATCAGCAATTATTTCAGGAAGGAAAGAAAGCAAATCTAAAGA

AAGAAACTAAATACACTGTAGCAAGAAATAACTCTTCAATCATGCTTTAACTTTTTACCATAGTCTCAGCTATACAAAAAACTTTAGTTTGAAGATTTTA

CATTGCTGTTAATTTGAAATCTGTTGTTCTTACTGTGGAGTTTGATTTGTTCGTTTGTTTGCTTTCTGTTGGTTTTTTTTTTTTTTTTTAAGATGTTTCT

AAATAGATTTTTTAAAAAAAAGAAAGAAGAAGAAGAATGGAATCTGGTTGCTATTTTAAGGTAGAACCTGAGACTTTTTGTGGTTCTTCATGTCCTCTGT

AAAATTTGGTGTCAAGAGTCATCAACTCTGAGGTTGTCCCTTCTGTTCTGCTTTATATTACTGCCCATCAGGAAATGGGAACCTGGTGAATATATAATGA

ATTGTAAAATATTTTAAATGTGTAACTTTTTCAACTGTGAAACTGACTATTGGTTTTTTTTTTTTTTGATGAAAACAGCTGCTCATAAAGTATTTTGTGT

AAA
Translation
 - UNI17136 - MPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKHIYNKLDKG GQIIVVIWVIVSPNNDKQK

YTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYK YIRSCIMLGRMPNLMLMAKESLYSQLPIDSFTMP

SYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDK IYVRTGIYHGGEPLCDNVNTQRVPCSNPR RWNEWLNYDIYIPDLPRAARL

CLSICSVKGRKGAKE EHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNK ETPCLELEFDWFSSVVKFPDMSVIEEHANWSV

SREAGFSYSHTGL SNRLARDNELRENDKEQLRALCTRDPLSEITEQEKDFLWSHR RHYCVTIPEILPKLLLSVKWNSRDEVAQ MYCLVKDWPPIKPE

QAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQ VLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLK KSEMHNKTVSQRFGLLLESYCR

ACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQK VQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLR RLEECRIMSSAKRPLWLNWENPDIMS

ELLFQNNEIIFKNGDD DLRQDMLTLQIIRIMENIWQNQGLDLR RMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNK

GEI IYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQ LFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQEYTKTREFER RFQ

EMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFHTIKQHALN
Transcript ENSMUST00000108243
Sequence
TCTCGCCGGGCCTTCCTTTCCGGAGCCGGGTGTCGGCTCGCGGGCGCTCGTCTTCTCCGTGCCTCCCCTGCGATCCAGGGACCGTGCGGCCTCTTCTGCC

GCTCGCGGACGGTGTCAGCCTCCGCTCTAC - UNI36819 - GGCACTGTTTGGAGACAGTCGTGATTCTGACTCCATAAGGCGGTTTTCTATGTAAA

GTTTGCAGAGGGTCAGAGCAATGCCTCCACGACCATCTTCGGGTGAACTGTGGGGCATCCACTTGATGCCCCCACGAATCCTAGTGGAATGTTTACTCCC

CAATGGAATGATAGTGACTTTAGAATGCCTCCGTGAGGCCACACTCGTCACCATCAAACATGAACTGTTCAGAGAGGCCAGGAAATACCCTCTCCATCAG

CTTCTGCAAGACGAAACTTCTTACATTTTCGTAAGTGTCACCCAAGAAGCAGAAAGGGAAGAATTTTTTGATGAAACAAGACGACTTTGTGACCTTCGGC

TTTTTCAACCCTTTTTAAAAGTTATTGAACCAGTAGGCAACCGTGAAGAAAAGATCCTCAATCGAGAAATTG - UNI17136 - GTTTTGTTATTGGC

ATGCCAGTGTGTGAATTTGATATGGTTAAAGATCCAGAAGTCCAAGACTTTCGAAGGAACATTCTGAATGTTTGCAAAGAAGCTGTGGACCTGCGGGATC

TCAACTCGCCTCATAGCAGAGCAATGTATGTCTACCCTCCAAATGTCGAGTCTTCCCCAGAACTGCCAAAGCACATCTACAACAAGTTAGATAAAG GAC

AAATCATAGTGGTGATTTGGGTAATAGTCTCTCCAAACAACGACAAGCAGAAGTACACTCTGAAGATCAATCATGACTGTGTGCCAGAGCAAGTCATTGC

TGAAGCCATCAGGAAAAAGACTCGGAGCATGTTGTTGTCCTCTGAGCAGCTGAAACTCTGTGTCTTAGAATATCAGGGCAAGTATATTCTGAAAGTGTGT

GGCTGTGACGAATACTTCCTGGAAAAGTACCCTCTGAGTCAGTACAAG TACATAAGAAGCTGTATAATGCTGGGGAGGATGCCCAACTTGATGCTGATG

GCCAAAGAAAGCCTATACTCTCAGCTGCCGATTGATAGCTTCACCATGCCGTCATACTCCAGGCGCATCTCCACAGCCACACCCTACATGAATGGAGAGA

CATCTACGAAATCCCTCTGGGTCATAAATAGTGCGCTCAGAATAAAAATTCTTTGTGCAACCTATGTAAATGTAAATATTCGAGACATTGATAAG ATCT

ATGTTCGAACAGGTATCTACCATGGAGGAGAACCCTTATGTGACAATGTGAACACTCAAAGAGTACCTTGTTCCAATCCTAG GTGGAATGAATGGCTGA

ATTATGATATATACATTCCTGATCTTCCTCGTGCTGCGCGCCTTTGCCTTTCAATCTGCTCTGTTAAAGGCCGAAAGGGTGCTAAGGAG GAGCACTGTC

CGTTGGCCTGGGGAAACATAAACTTGTTTGATTATACAGACACCCTAGTGTCCGGGAAAATGGCTTTGAATCTCTGGCCTGTACCGCATGGGTTAGAAGA

TCTGCTGAACCCTATTGGTGTTACTGGGTCAAATCCAAATAAA GAAACTCCATGCTTAGAGTTGGAGTTTGATTGGTTCAGCAGTGTGGTGAAGTTTCC

AGACATGTCTGTGATCGAAGAACATGCCAATTGGTCCGTGTCCCGAGAAGCTGGATTCAGTTACTCCCATACAGGACTG AGTAACAGACTAGCCAGAGA

CAATGAGTTAAGAGAAAATGACAAGGAACAGCTCCGAGCACTTTGCACCCGGGACCCACTATCTGAAATCACTGAACAAGAGAAAGACTTCCTATGGAGC

CACAG ACACTACTGCGTAACTATTCCTGAAATCCTACCCAAATTGCTTCTGTCTGTCAAGTGGAATTCCAGAGACGAAGTGGCCCAG ATGTACTGCTT

AGTAAAAGATTGGCCTCCAATCAAACCAGAGCAAGCCATGGAACTCCTGGACTGTAACTATCCAGATCCTATGGTTCGGAGTTTTGCTGTTCGGTGCTTA

GAAAAATATTTAACAGATGACAAACTTTCTCAGTACCTCATTCAACTTGTACAG GTCTTAAAATATGAACAGTATTTGGATAACCTGCTTGTGAGATTT

TTACTCAAGAAAGCATTGACAAATCAAAGGATTGGCCATTTTTTCTTTTGGCATTTAAA ATCTGAGATGCACAATAAGACTGTCAGTCAGAGGTTTGGC

CTGCTATTGGAGTCCTACTGCCGTGCCTGTGGGATGTATCTGAAGCACCTGAACAGACAAGTAGAGGCCATGGAGAAGCTCATCAACCTAACGGACATCC

TTAAGCAGGAGAAGAAGGATGAGACACAAAAG GTACAGATGAAGTTTTTGGTTGAACAGATGAGACAGCCAGACTTCATGGATGCTTTGCAGGGTTTTC

TGTCCCCTCTGAATCCTGCTCACCAACTAGGAAACCTCAG GCTTGAAGAGTGTCGAATTATGTCCTCTGCAAAAAGGCCACTGTGGTTGAATTGGGAGA

ACCCAGACATCATGTCAGAGCTACTGTTTCAGAACAATGAGATCATCTTTAAAAATGGCGACG ACTTACGGCAAGATATGTTAACCCTTCAGATCATCC

GAATCATGGAGAACATCTGGCAAAACCAAGGCCTTGACCTTCG CATGCTACCTTATGGCTGTCTATCCATTGGGGACTGTGTGGGTCTCATCGAGGTGG

TGAGAAACTCTCACACCATCATGCAAATCCAGTGCAAAGGAGGCCTGAAGGGGGCGCTGCAGTTCAACAGCCACACACTGCATCAATGGCTCAAGGACAA

GAACAAGGGCGAGAT ATATGATGCAGCCATTGACCTGTTCACTCGGTCCTGCGCTGGGTACTGCGTGGCAACCTTTATCTTGGGAATTGGAGACCGGCA

CAACAGCAACATCATGGTGAAAGATGACGGACAG CTGTTTCATATAGATTTTGGGCACTTTTTGGATCACAAGAAGAAAAAATTTGGCTATAAGCGGGA

ACGTGTGCCATTTGTGTTGACACAGGATTTCTTGATTGTGATTAGTAAGGGAGCACAAGAGTACACCAAGACCAGAGAGTTTGAGAG GTTTCAGGAGAT

GTGTTACAAGGCTTACCTAGCAATTCGGCAGCATGCCAATCTCTTCATCAACCTTTTTTCAATGATGCTTGGCTCTGGAATGCCAGAACTACAATCTTTT

GATGACATTGCATATATCCGAAAGACTCTAGCCTTGGACAAAACTGAGCAAGAAGCTTTGGAATATTTCACAAAGCAAATGAATGATGCACATCATGGTG

GATGGACGACAAAAATGGATTGGATCTTCCACACCATCAAGCAGCATGCTTTGAACTGAGATGGGAGCTGGGACTGCGAGCTGGCTCCCGGCTTCTCCAC

TGCATGGCAGTGAGTGGCAGCAGGCAGGCAGTGGCATGGGATGGCACAGTCAGGAACAACATTAGGACTTGAGCAAGAACATAAACAACGTGCTCTATAA

TTGAAACACTGTACACGCAAGCAGGGTTTGATAGCACTAAACTAGTTTATTTCAAAATCCAGCTTTAGAATAACGAGCAATTTCATGTTATGCCTTAAGT

CCAAAAAAGGTAAACTTTGAAGATTGTTTGTATCTTTTTTTAAAAAAACAAAACAAAACAAAAATCCCCAAAATACATACAAATGATGGAGACAAAACTA

GAATGCTGTTGTTTGTCTGCCAGTGTTCTGTCTAACACGTGGACACGCCCAAGGCTGTGACTGCTATAGGTCTGAGTAAGCTAAAGCTTATATTAAGTTA

CATGAATTGGAGAAGAAGGAAAATTCTGATTTTCCCATTGCTGTTCAGACTTAACGATTTGAAGTGGGGATTTTGATCCCTGCTTAATGAGGAACAACAC

TTGGGGTGAAGGGACTCGCTTTTTGCTTTGAACAAACAACACTTTGATGGACTTGGGGTCTCACCTGCGGTTTTGAAAGCAGTCACAATACTTGCAGACA

GCTGCGTTTTTGTTGGGTGTTGTTTTTTGTTGTTTTTTTCTCTGGACAGTATTTACAAGGATCTGACTTATTTCCTAGGGAAATTCTGGGCTGGCATCAA

GTATAGCAGTAAGGGCAGAGGAGAGGCCGCAGGGAGCCCCTGTTCCTGACCTGTACAGTGTTCACTTTCAGCTGATTGTTTCTCCTTTTGCAATTGAACT

GAATACTTTTTTTTCATGCATGTTTTCCAGAAAATAGAAGTGAGTATTAATGTTATTAAAAAGATTATTTTTTTTTATTAAAGGCTATTTATATTATAGA

AACTATCATTAATATATATTCTTTATTTACATAATCTGTCCCATAGTCATGCATTGTTTTGCACCCCAAATTTTTTATCGTTGGTAACAGCATGGTTAGC

TTTTCTCTCGGTCTGTAGATGAGGCTCAGGCACTATTCCATTTATCCAATACCCGTGTATGACTCCTTAAGGAACAGATTGAATCGCACACGCTTTCCTG

CCGCTGCTGGCCGTTTTTTACACGACGCCCTCATCCATTCCTCCGTAGTTGAGACAGCACAATCACATGAAACCCGTTACTAAAATGAATACAAAACCGA

CTATCATCCTGACTCTTAATCCTTCTGCAGAGGTCTAGTCATGAGTGACTCTTTACATTATGAGAGACTGGAAACCATGAATTTTTTACCTTCGTAAGCT

ACGTATCCGTACTTCAATGATAAAAGTAGGACATTAACCCATTTTACTATCATGTCCCAATTCCAAGTGGTGAGGTCTCACTCCAGTGTCATTAAATCCC

ATTCAGGCACGGTGCATTAGTGAGCATTCTGAAATGCATCCATCTAAGATGTAGGGCTAATGTTAGTGGTCGCTCTAGATTTCTACTCAGTGTTTGAATG

ATTCATGTCCTAGAAAATAGCTTTAGCAGATACTCAGATGCCACACCAAAAAAAGAAGAAAAAAAGAAAAAAAAAAGAATAAATAAAAAGGAAAAAAAAA

AGAAAAACTGTGCAATAATCTCCTGACAGTTCCTAGCTCAGGCGTTCCTGGGGAGCATCGTTATGAAGAGCGCACGCTGTACACGCTAGAAAACAGAATC

CCTGTAATACAGTGCTCACCTTGAGGCCAGACACCTATATAGACGTTTTGAATAGTGAACAGGGGACTCTAATAGAAATACTCTTAATATCTGCCTATTT

TTAGAACCCTTAAAGGGCATAATTATTGAAGATTTAGGTACTTCACTAAAGCATGTATATATTATTGCCAACAAGAAAAATAAACCTGAAGATTAGGGGA

ACTTGGTTCTGTAAACTGTCTTGGAATAGTTAAGCAGAATTTAAGCTCTGTTTTATGCAGAAAACCAGATAGATTCTTTTGCAGATATAGAAAACTTCCT

AACTTATTTAAACTTGGCATTTAACACTTTGTGTTACTTAGATATACAGTTGCTAGGTACTAACATCCCATTCTTCTCTATATCAGGGATTATTACAGTC

AAACTCAGTGACATGGTACAAATCTACAACTTTGATGGTGGGAACTGAAGAATTACAGAGAACTGTGTTTTCCCGAGTGCCAAAAGAAACAAAAACAAAA

CAAAACAAACAAACCCCACAAAAAAAAGAAAAAAAAAAAAAAGCCGCGAGCCTCCTTGCACAAAATTGATAGGTTTTTTTTTGTGTGTATGTGTGTGTTT

GTGTGTGTGTATGTTTAACATTAGTCCATCAGTTGCCGTAGTATCACCTCCCAGGTCTCTGCACAATTAAAACACAGCCACATAGCTTATTTTGTCATTT

ACAACCACATTGATTTTATTTGAAAGAAAGTCTATAGTCTGTGAAGGGTATAAGTAAAGAAAGGAGAACTGGTTGTATTCAAAAAGGCAAAAGCCAAACT

TGAATTGCAGCTGGGGTGATCAATATCTGCTTCCAGAGAGCAATAATGTGCCACTTACTCCCAGGTGCTTCAGTACCAGAAAGTGCTGTGGGACTCGGTC

ACCTCTGTAGATGACCGTCCTTGTCAGTGAATGACTATTGTGGAAATGACTTGGGCTCCATAGTTTCACTAAGTCACTTGAGGATGTCTCATCAGCAATT

ATTTCAGGAAGGAAAGAAAGCAAATCTAAAGAAAGAAACTAAATACACTGTAGCAAGAAATAACTCTTCAATCATGCTTTAACTTTTTACCATAGTCTCA

GCTATACAAAAAACTTTAGTTTGAAGATTTTACATTGCTGTTAATTTGAAATCTGTTGTTCTTACTGTGGAGTTTGATTTGTTCGTTTGTTTGCTTTCTG

TTGGTTTTTTTTTTTTTTTTTAAGATGTTTCTAAATAGATTTTTTAAAAAAAAGAAAGAAGAAGAAGAATGGAATCTGGTTGCTATTTTAAGGTAGAACC

TGAGACTTTTTGTGGTTCTTCATGTCCTCTGTAAAATTTGGTGTCAAGAGTCATCAACTCTGAGGTTGTCCCTTCTGTTCTGCTTTATATTACTGCCCAT

CAGGAAATGGGAACCTGGTGAATATATAATGAATTGTAAAATATTTTAAATGTGTAACTTTTTCAACTGTGAAACTGACTATTGGTTTTTTTTTTTTTTG

ATGAAAACAGCTGCTCATAAAGTATTTTGTGTAAA
Translation
 - UNI36819 - MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFREARKYPLHQLLQDETSYIFVSVTQEAEREEFFDET

RRLCDLRLFQPFLKVIEPVGNREEKILNREIG - UNI17136 - GFVIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNV

ESSPELPKHIYNKLDKG GQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQ

YK YIRSCIMLGRMPNLMLMAKESLYSQLPIDSFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDK IYVRTGIYHGGEPL

CDNVNTQRVPCSNPR RWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKE EHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGS

NPNK ETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHTGL SNRLARDNELRENDKEQLRALCTRDPLSEITEQEKDFLWSHR RHYCVT

IPEILPKLLLSVKWNSRDEVAQ MYCLVKDWPPIKPEQAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQ VLKYEQYLDNLLVRFLLKKAL

TNQRIGHFFFWHLK KSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQK VQMKFLVEQMRQPDFMDALQGFLSPL

NPAHQLGNLR RLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDD DLRQDMLTLQIIRIMENIWQNQGLDLR RMLPYGCLSIGDCVGLIE

VVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEI IYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQ LFHIDFGHFLDHKKKKFG

YKRERVPFVLTQDFLIVISKGAQEYTKTREFER RFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMN

DAHHGGWTTKMDWIFHTIKQHALN
Transcript ENSMUST00000029201
Sequence
TGATTCTGACTCCATAAGGCGGTTTTCTATGTAAAGTTTGCAGAGGGTCAGAGCAATGCCTCCACGACCATCTTCGGGTGAACTGTGGGGCATCCACTTG

ATGCCCCCACGAATCCTAGTGGAATGTTTACTCCCCAATGGAATGATAGTGACTTTAGAATGCCTCCGTGAGGCCACACTCGTCACCATCAAACATGAAC

TGTTCAGAGAGGCCAGGAAATACCCTCTCCATCAGCTTCTGCAAGACGAAACTTCTTACATTTTCGTAAGTGTCACCCAAGAAGCAGAAAGGGAAGAATT

TTTTGATGAAACAAGACGACTTTGTGACCTTCGGCTTTTTCAACCCTTTTTAAAAGTTATTGAACCAGTAGGCAACCGTGAAGAAAAGATCCTCAATCGA

GAAATTG - UNI17136 - GTTTTGTTATTGGCATGCCAGTGTGTGAATTTGATATGGTTAAAGATCCAGAAGTCCAAGACTTTCGAAGGAACATTCT

GAATGTTTGCAAAGAAGCTGTGGACCTGCGGGATCTCAACTCGCCTCATAGCAGAGCAATGTATGTCTACCCTCCAAATGTCGAGTCTTCCCCAGAACTG

CCAAAGCACATCTACAACAAGTTAGATAAAG GACAAATCATAGTGGTGATTTGGGTAATAGTCTCTCCAAACAACGACAAGCAGAAGTACACTCTGAAG

ATCAATCATGACTGTGTGCCAGAGCAAGTCATTGCTGAAGCCATCAGGAAAAAGACTCGGAGCATGTTGTTGTCCTCTGAGCAGCTGAAACTCTGTGTCT

TAGAATATCAGGGCAAGTATATTCTGAAAGTGTGTGGCTGTGACGAATACTTCCTGGAAAAGTACCCTCTGAGTCAGTACAAG TACATAAGAAGCTGTA

TAATGCTGGGGAGGATGCCCAACTTGATGCTGATGGCCAAAGAAAGCCTATACTCTCAGCTGCCGATTGATAGCTTCACCATGCCGTCATACTCCAGGCG

CATCTCCACAGCCACACCCTACATGAATGGAGAGACATCTACGAAATCCCTCTGGGTCATAAATAGTGCGCTCAGAATAAAAATTCTTTGTGCAACCTAT

GTAAATGTAAATATTCGAGACATTGATAAG ATCTATGTTCGAACAGGTATCTACCATGGAGGAGAACCCTTATGTGACAATGTGAACACTCAAAGAGTA

CCTTGTTCCAATCCTAG GTGGAATGAATGGCTGAATTATGATATATACATTCCTGATCTTCCTCGTGCTGCGCGCCTTTGCCTTTCAATCTGCTCTGTT

AAAGGCCGAAAGGGTGCTAAGGAG GAGCACTGTCCGTTGGCCTGGGGAAACATAAACTTGTTTGATTATACAGACACCCTAGTGTCCGGGAAAATGGCT

TTGAATCTCTGGCCTGTACCGCATGGGTTAGAAGATCTGCTGAACCCTATTGGTGTTACTGGGTCAAATCCAAATAAA GAAACTCCATGCTTAGAGTTG

GAGTTTGATTGGTTCAGCAGTGTGGTGAAGTTTCCAGACATGTCTGTGATCGAAGAACATGCCAATTGGTCCGTGTCCCGAGAAGCTGGATTCAGTTACT

CCCATACAGGACTG AGTAACAGACTAGCCAGAGACAATGAGTTAAGAGAAAATGACAAGGAACAGCTCCGAGCACTTTGCACCCGGGACCCACTATCTG

AAATCACTGAACAAGAGAAAGACTTCCTATGGAGCCACAG ACACTACTGCGTAACTATTCCTGAAATCCTACCCAAATTGCTTCTGTCTGTCAAGTGGA

ATTCCAGAGACGAAGTGGCCCAG ATGTACTGCTTAGTAAAAGATTGGCCTCCAATCAAACCAGAGCAAGCCATGGAACTCCTGGACTGTAACTATCCAG

ATCCTATGGTTCGGAGTTTTGCTGTTCGGTGCTTAGAAAAATATTTAACAGATGACAAACTTTCTCAGTACCTCATTCAACTTGTACAG GTCTTAAAAT

ATGAACAGTATTTGGATAACCTGCTTGTGAGATTTTTACTCAAGAAAGCATTGACAAATCAAAGGATTGGCCATTTTTTCTTTTGGCATTTAAA ATCTG

AGATGCACAATAAGACTGTCAGTCAGAGGTTTGGCCTGCTATTGGAGTCCTACTGCCGTGCCTGTGGGATGTATCTGAAGCACCTGAACAGACAAGTAGA

GGCCATGGAGAAGCTCATCAACCTAACGGACATCCTTAAGCAGGAGAAGAAGGATGAGACACAAAAG GTACAGATGAAGTTTTTGGTTGAACAGATGAG

ACAGCCAGACTTCATGGATGCTTTGCAGGGTTTTCTGTCCCCTCTGAATCCTGCTCACCAACTAGGAAACCTCAG GCTTGAAGAGTGTCGAATTATGTC

CTCTGCAAAAAGGCCACTGTGGTTGAATTGGGAGAACCCAGACATCATGTCAGAGCTACTGTTTCAGAACAATGAGATCATCTTTAAAAATGGCGACG A

CTTACGGCAAGATATGTTAACCCTTCAGATCATCCGAATCATGGAGAACATCTGGCAAAACCAAGGCCTTGACCTTCG CATGCTACCTTATGGCTGTCT

ATCCATTGGGGACTGTGTGGGTCTCATCGAGGTGGTGAGAAACTCTCACACCATCATGCAAATCCAGTGCAAAGGAGGCCTGAAGGGGGCGCTGCAGTTC

AACAGCCACACACTGCATCAATGGCTCAAGGACAAGAACAAGGGCGAGAT ATATGATGCAGCCATTGACCTGTTCACTCGGTCCTGCGCTGGGTACTGC

GTGGCAACCTTTATCTTGGGAATTGGAGACCGGCACAACAGCAACATCATGGTGAAAGATGACGGACAG CTGTTTCATATAGATTTTGGGCACTTTTTG

GATCACAAGAAGAAAAAATTTGGCTATAAGCGGGAACGTGTGCCATTTGTGTTGACACAGGATTTCTTGATTGTGATTAGTAAGGGAGCACAAGAGTACA

CCAAGACCAGAGAGTTTGAGAG GTTTCAGGAGATGTGTTACAAGGCTTACCTAGCAATTCGGCAGCATGCCAATCTCTTCATCAACCTTTTTTCAATGA

TGCTTGGCTCTGGAATGCCAGAACTACAATCTTTTGATGACATTGCATATATCCGAAAGACTCTAGCCTTGGACAAAACTGAGCAAGAAGCTTTGGAATA

TTTCACAAAGCAAATGAATGATGCACATCATGGTGGATGGACGACAAAAATGGATTGGATCTTCCACACCATCAAGCAGCATGCTTTGAACTGAGATGGG

AGCTGGGACTGCGAGCTGGCTCCCGGCTTCTCCACTGCATGGCAGTGAGTGGCAGCAGGCAGGCAGTGGCATGGGATGGCACAGTCAGGAACAACATTAG

GACTTGAGCAAGAACATAAACAACGTGCTCTATAATTGAAACACTGTACACGCAAGCAGGGTTTGATAGCACTAAACTAGTTTATTTCAAAATCCAGCTT

TAGAATAACGAGCAATTTCATGTTATGCCTTAAGTCCAAAAAAGGTAAACTTTGAAGATTGTTTGTATCTTTTTTTAAAAAAACAAAACAAAACAAAAAT

CCCCAAAATACATACAAATGATGGAGACAAAACTAGAATGCTGTTGTTTGTCTGCCAGTGTTCTGTCTAACACGTGGACACGCCCAAGGCTGTGACTGCT

ATAGGTCTGAGTAAGCTAAAGCTTATATTAAGTTACATGAATTGGAGAAGAAGGAAAATTCTGATTTTCCCATTGCTGTTCAGACTTAACGATTTGAAGT

GGGGATTTTGATCCCTGCTTAATGAGGAACAACACTTGGGGTGAAGGGACTCGCTTTTTGCTTTGAACAAACAACACTTTGATGGACTTGGGGTCTCACC

TGCGGTTTTGAAAGCAGTCACAATACTTGCAGACAGCTGCGTTTTTGTTGGGTGTTGTTTTTTGTTGTTTTTTTCTCTGGACAGTATTTACAAGGATCTG

ACTTATTTCCTAGGGAAATTCTGGGCTGGCATCAAGTATAGCAGTAAGGGCAGAGGAGAGGCCGCAGGGAGCCCCTGTTCCTGACCTGTACAGTGTTCAC

TTTCAGCTGATTGTTTCTCCTTTTGCAATTGAACTGAATACTTTTTTTTCATGCATGTTTTCCAGAAAATAGAAGTGAGTATTAATGTTATTAAAAAGAT

TATTTTTTTTTATTAAAGGCTATTTATATTAT
Translation
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFREARKYPLHQLLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLK

VIEPVGNREEKILNREIG - UNI17136 - GFVIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKHIYNKL

DKG GQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYK YIRSCIMLGRM

PNLMLMAKESLYSQLPIDSFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDK IYVRTGIYHGGEPLCDNVNTQRVPCSNP

R RWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKE EHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNK ETPCLELEF

DWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHTGL SNRLARDNELRENDKEQLRALCTRDPLSEITEQEKDFLWSHR RHYCVTIPEILPKLLLSVKW

NSRDEVAQ MYCLVKDWPPIKPEQAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQ VLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLK

 KSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQK VQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLR RLE

ECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDD DLRQDMLTLQIIRIMENIWQNQGLDLR RMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCK

GGLKGALQFNSHTLHQWLKDKNKGEI IYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQ LFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF

LIVISKGAQEYTKTREFER RFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWI

FHTIKQHALN

For any suggestions or comments, please send an email to unitrap@crg.es