Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027674 (Pex2)
Chromosomal location
Chr 3: 32848876 - 33042169 (-)
Description
peroxisomal biogenesis factor 5-like Gene [Source:MGI (curated);Acc:Pex2-002]
RefSeq_dna
NM_021483 
RefSeq_peptide
NP_067458.1 
MGI
MGI:1916672 MGI:107486 
Uniprot/SWISSPROT
Q8C437 
Human Ortholog
ENSG00000114757 (PEX5L)
Omim not available
UniTrap UNI30748
Vector Insertion
Chr 3: 32981737 - 33042005
Public Clones IST14904G11 (tigm) IST14458E12 (tigm) IST14610F11 (tigm) IST14745E10 (tigm)
IST14606A3 (tigm) IST13862F4 (tigm) IST13861F4 (tigm) IST10885F5 (tigm)
IST14511E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108219
Sequence
GCCCTGCGCTCGGCAGCTGCGGCGGCGGCTGGCGCGGGCTGGCGTCCGGACGGAGGCGGGAGGGGACGCTGCAGCCTCGTGAGCGGCGAGGAGAGTGGGG

CACAGGACCGGCGAGTTGGAGAGGCGCGGCGAGCGGCACTGCGCCCGCGGAGAGCCCGGCCCCGCGTCCCCGTGCCCGCGCGCGCTCAGCACCCGCGTGG

AGGACAGCTCCGCAGCGCGCCGCTCGCCCAGCCGCCCTCTCGCCCGCCGGCGTCCTGTAGCCCGTAGCCCGGGCGCCCCGCGGAGAGCCCGCGCCGCGCT

GCCCGACCCGCAACTCTCTACGAGCTAGCTCGGGAGAGCAGCCATCAGCCTCGGGTGCCCTGAGGACGCCGGAGCAGAATGTACCAGGGACACATGCAG 

- UNI30748 - AAAAGTAAAGAACAAGGCTATGGCAAGCTAAGCAGTGACGAGGACCTGGAAATAATTGTTGACCAGAAGCAG GGAAAAGGCTCTAG

GGCTGCAGATAAGGCTGTTGCCATGGTGATGAAGGAGATACCGAGGGAGGAGTCTGCAGAAGAAAAGCCCCTCCTTACTGTGACATCACAG CTGGTGAA

TGAGCAACAAGAGAGCAGACCCCTCCTGAGCCCCTCCATCGACGACTTCCTCTGCGAAACCAAATCGGAGGCCATTGCAAAGCCAGTGACATCCAACACA

GCCG TGTTGACCACTGGCTTGGATCTCCTTGACCTGAGTGAACCCGTCTCTCAAACCCAAACCAAAGCCAAGAAATCTGAGCCCTCATCAAAGAGCTCG

TCCCTCAAGAAGAAAGCTGATGGCTCCGACCTCATCAGTGCAGATGCTGAGCAGAGAGCACAGGCTCTCCGAGGGCCAGAGACATCATCCTTAGATTTAG

 TAGACATTCAAACACAACTGGAAAAATGGGATGATGTCAAGTTTCACGGTGACCGAACAAGCAAGGGGCATCTCATGGCAGAAAGGAAATCATGCTCTT

CCAGAACTGGGTCCAAAGAGCTTCTTTG GTCCGCAGAACACAGATCTCAGCCAGAGCTGAGTACTGGGAAAAGCGCCCTCAACTCTGAGTCGGCTTCCG

AGTTGGAACTTGTAGCTCCAGCACAG GCTCGGCTGACCAAAGAGCATCGCTGGGGAAGTGCCCTGCTCTCCAGGAACCATTCCTTGGAAGAGGAGTTTG

AAAGGGCAAAAGCGGCAGTAGAG TCAGATACAGAGTTCTGGGATAAGATGCAGGCAGAATGGGAGGAAATGGCCCGGAGGAACTGGATATCCGAGAACC

AGGAAGCTCAGAACCAAGTCACCGTCTCGGCCAGTGAGAAG GGATATTACTTCCACACTGAAAATCCCTTCAAGGACTGGCCTGGAGCATTTGAAGAAG

GCTTAAAAAGGTTGAAGGAAGGGGACCTGCCTGTCACCATCCTGTTCATGGAAGCTGCAATTCTTCAGGACCCTGGAGACGCTGAGGTGGCATTGCCCTT

CCCTCTGTCCAGACTGGGATAGTGCCTGTGTGTGCTAAGGGGTCAGAATGAGATGGGGACGCTGCAGGGTGCATGGTCAGCAAGGTTTACAACAATTCCC

TTGGCTTGGGCTGATTATGTTAGAAAGCAATACATTGCCTACTTTCTAACTGAGCTTCTCGTCTTTAAGATCCAGAGCCCCTGAAGATAAAACCTAAAGA

CAGAAAACACAGAGATAGCAATGTGGTACACACCTTTCATCCCAACACAGGGGTGGAGCAGAGGCAGGCAGAACTCTGAGTTCTAGACCAGCCTGTTCTA

CATTGAGAGGTCCTGGCCAGTCAGGGCCTCACAGGACCATCCAGCCTTTAAAAAAAAAATGGCAAACATGAGGCTCCCCCCGTGGTATTTAGGAAGGAAA

ATGGCTTTTGTCAGGGTCTCCAGTCACACCATGTATCACCCCTCATTTACTCTCCCAACGTTTATGGGATGTCTACTGTCTACTCAAAACCACACTAAGT

CCCGGCATACAATGCTGAAGAGTTGGGGAAATGAGCAGGGGTTAAGAGGATACCTTTGTGCCTCATCTGGAGGGCTGAGTAAATAAAGTCTGGGGTCACA

GAGGAGTAGAACCTAGAGGGTGTGGCTGGTCCTCCCCTCAGGTAGCTTCCCTGTAATAAAGTGTGCTCCCCACAGGGGATCACAGCTAAACTAACTAAAA

TAGCAAGCAAGCCTGCTTCATTCTGCAATGGTAACAGTCTGCTTTGTGTTTGTCTGTTTTCTTGTGTTGGTTTGGTTTGGGTTTTTGGTTGGT
Translation
MYQGHMQ - UNI30748 - KSKEQGYGKLSSDEDLEIIVDQKQ GKGSRAADKAVAMVMKEIPREESAEEKPLLTVTSQ LVNEQQESRPLLSPSIDD

FLCETKSEAIAKPVTSNTAV VLTTGLDLLDLSEPVSQTQTKAKKSEPSSKSSSLKKKADGSDLISADAEQRAQALRGPETSSLDLV VDIQTQLEKWDD

VKFHGDRTSKGHLMAERKSCSSRTGSKELLW WSAEHRSQPELSTGKSALNSESASELELVAPAQ ARLTKEHRWGSALLSRNHSLEEEFERAKAAVE S

DTEFWDKMQAEWEEMARRNWISENQEAQNQVTVSASEK GYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEVALPFPLSRLG
Transcript ENSMUST00000108221
Sequence
ACACCAATTTTGATTTCTAAAACAAACTGAAGTGTGAAAAAGGAGCTCGTAACCTGCATGGACATATAAAAGTATCACTGAATTTATCG TCAGATACAG

AGTTCTGGGATAAGATGCAGGCAGAATGGGAGGAAATGGCCCGGAGGAACTGGATATCCGAGAACCAGGAAGCTCAGAACCAAGTCACCGTCTCGGCCAG

TGAGAAG GGATATTACTTCCACACTGAAAATCCCTTCAAGGACTGGCCTGGAGCATTTGAAGAAGGCTTAAAAAGGTTGAAGGAAGGGGACCTGCCTGT

CACCATCCTGTTCATGGAAGCTGCAATTCTTCAGGACCCTGGAGACGCTGAG GCATGGCAGTTTCTTGGTATAACCCAGGCTGAGAATGAAAATGAGCA

GGCAGCTATTGTCGCCCTCCAGAG GTGCCTGGAGTTGCAGCCCAACAACTTGAAGGCTCTGATGGCCTTGGCTGTAAGTTACACCAACACCAGCCACCA

GCAGGATGCTTGTGAGGCACTGAAGAACTGGATTAAGCAAAACCCAAAGTACAAGTACCTTGTGAAGAACAAGAAAGGCTCTCCAGGCCTCACACGGCGG

ATGTCTAAATCCCCAGTTGACAG CTCTGTTCTGGAAGGAGTGAAGGAGTTGTACCTGGAAGCTGCCCACCAAAATGGTGACATGATTGACCCAGACCTG

CAGACAGGTCTGGGAGTTCTGTTCCACCTGAGTGGAGAGTTCAATAGAGCAATCGATGCATTTAATGCTGCCTTAACAGTTCGGCCAGAG GATTACTCA

CTGTGGAACCGTCTTGGGGCAACCTTGGCAAATGGAGACCGCAGTGAGGAAGCTGTGGAGGCCTACACGAGAGCACTGGAGATCCAGCCAGGTTTCATCC

GCTCCAGATACAACCTGGGGATCAGCTGCATCAACCTGGGTGCCTACAG AGAAGCGGTCAGCAACTTCCTCACTGCCCTCAGCTTGCAGAGGAAGAGCA

GGAACCAGCAGCAAGTCCCTCACCCTGCCATCTCCGGGAACATCTGGGCCGCCCTCAGGATTGCCCTGTCGCTGATGGACCAGCCGGAGCTCTTCCAGGC

CGCCAACCTCGGTGACTTGGATGTCCTCCTGAGAGCTTTCAATTTGGATCCTTGAAGGAAAAGAAGACAAGAATAATAAAGGATACTAATGTGT
Translation
 MQAEWEEMARRNWISENQEAQNQVTVSASEK GYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAE AWQFLGITQAENENEQAA

IVALQR RCLELQPNNLKALMALAVSYTNTSHQQDACEALKNWIKQNPKYKYLVKNKKGSPGLTRRMSKSPVDS SSVLEGVKELYLEAAHQNGDMIDPD

LQTGLGVLFHLSGEFNRAIDAFNAALTVRPE DYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYR REAVSNFLTALSLQ

RKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRAFNLDP
Transcript ENSMUST00000108224
Sequence
AGTTCACTCCTCTGACTGATGTGCAAGGTCTTGCAGAAGCCAGGGACTTGCATTCTGGGCTTGGCAAAGTGCTTAGGAAGACGACAGGGCTTCCCGGCTG

GGAGGAGGGAGGAGAGAGGAGAGCTGAAGATCCCCGCCTGGGCTGGCTCAGCTAAGCAAAGTGGGCAGCTCAGTACTTGAAAGAGGACTGTGCTCACTCG

CTCGCTCGCACTAGATATCA - UNI30748 - AAATCGGGTCATGCAGATGAGCTACTTG AAAAGTAAAGAACAAGGCTATGGCAAGCTAAGCAGTG

ACGAGGACCTGGAAATAATTGTTGACCAGAAGCAG CTGGTGAATGAGCAACAAGAGAGCAGACCCCTCCTGAGCCCCTCCATCGACGACTTCCTCTGCG

AAACCAAATCGGAGGCCATTGCAAAGCCAGTGACATCCAACACAGCCG TGTTGACCACTGGCTTGGATCTCCTTGACCTGAGTGAACCCGTCTCTCAAA

CCCAAACCAAAGCCAAGAAATCTGAGCCCTCATCAAAGAGCTCGTCCCTCAAGAAGAAAGCTGATGGCTCCGACCTCATCAGTGCAGATGCTGAGCAGAG

AGCACAGGCTCTCCGAGGGCCAGAGACATCATCCTTAGATTTAG TAGACATTCAAACACAACTGGAAAAATGGGATGATGTCAAGTTTCACGGTGACCG

AACAAGCAAGGGGCATCTCATGGCAGAAAGGAAATCATGCTCTTCCAGAACTGGGTCCAAAGAGCTTCTTTG GTCCGCAGAACACAGATCTCAGCCAGA

GCTGAGTACTGGGAAAAGCGCCCTCAACTCTGAGTCGGCTTCCGAGTTGGAACTTGTAGCTCCAGCACAG GCTCGGCTGACCAAAGAGCATCGCTGGGG

AAGTGCCCTGCTCTCCAGGAACCATTCCTTGGAAGAGGAGTTTGAAAGGGCAAAAGCGGCAGTAGAG TCAGATACAGAGTTCTGGGATAAGATGCAGGC

AGAATGGGAGGAAATGGCCCGGAGGAACTGGATATCCGAGAACCAGGAAGCTCAGAACCAAGTCACCGTCTCGGCCAGTGAGAAG GGATATTACTTCCA

CACTGAAAATCCCTTCAAGGACTGGCCTGGAGCATTTGAAGAAGGCTTAAAAAGGTTGAAGGAAGGGGACCTGCCTGTCACCATCCTGTTCATGGAAGCT

GCAATTCTTCAGGACCCTGGAGACGCTGAG GCATGGCAGTTTCTTGGTATAACCCAGGCTGAGAATGAAAATGAGCAGGCAGCTATTGTCGCCCTCCAG

AG GTGCCTGGAGTTGCAGCCCAACAACTTGAAGGCTCTGATGGCCTTGGCTGTAAGTTACACCAACACCAGCCACCAGCAGGATGCTTGTGAGGCACTG

AAGAACTGGATTAAGCAAAACCCAAAGTACAAGTACCTTGTGAAGAACAAGAAAGGCTCTCCAGGCCTCACACGGCGGATGTCTAAATCCCCAGTTGACA

G CTCTGTTCTGGAAGGAGTGAAGGAGTTGTACCTGGAAGCTGCCCACCAAAATGGTGACATGATTGACCCAGACCTGCAGACAGGTCTGGGAGTTCTGT

TCCACCTGAGTGGAGAGTTCAATAGAGCAATCGATGCATTTAATGCTGCCTTAACAGTTCGGCCAGAG GATTACTCACTGTGGAACCGTCTTGGGGCAA

CCTTGGCAAATGGAGACCGCAGTGAGGAAGCTGTGGAGGCCTACACGAGAGCACTGGAGATCCAGCCAGGTTTCATCCGCTCCAGATACAACCTGGGGAT

CAGCTGCATCAACCTGGGTGCCTACAG AGAAGCGGTCAGCAACTTCCTCACTGCCCTCAGCTTGCAGAGGAAGAGCAGGAACCAGCAGCAAGTCCCTCA

CCCTGCCATCTCCGGGAACATCTGGGCCGCCCTCAGGATTGCCCTGTCGCTGATGGACCAGCCGGAGCTCTTCCAGGCCGCCAACCTCGGTGACTTGGAT

GTCCTCCTGAGAGCTTTCAATTTGGATCCTTGAAGGAAAAGAAGACAAGAATAATAAAGGATACTAATGTGTCTTCTGTGTTATTATACTAAAAAGGGAC

AAAACTATTTTATTATGAATTTCCAAAACACATTTTTTTTAAAAAAGGATAAAGCTGAGAGGCAAAAGGCCATGGTCATATAAGCCAAGGGAATTGATTT

CTACAGATCCAGTCTCTGTTCAGACCCAAAAGCACAAAGCGAAGGTCGGGGTCAAGAGAAGAACTGAGATTCTCAGGACAAACCAAGATAAGGTAACTGC

ACTCGCTTCCAAATTGCAAGTGTACTTTGAGTTATATTGTTCCTGTCCCAGCTGGTGGCACATCTGAGGGACACTCTTGGGACATAACATGACAATTTGT

CCACAGTCAGTGAACTCAGGCTGTCTTTGTCTACCCTTTTGCAAGACTGAACATAGTTTGGGCCACTGGCAAATGTACACATGCAGCCATTGCTTCCCTC

TCGCCCACTCTAACCTTGACTGTAAGCCTTTGTTTTCAGAGACAGAGAGCTTTGCTGGCGAAAGCAGTTTTTGCACTAGAAGTTTTTGCTGTTCCCAATG

AAATCCTTTCTAGGATTGTACATAAGCACTTTAATATCTTATTTATGCCTTGCCGGGCTTCTGGCTTGCTGCTCCAGTTTCTAACTTGGGGGGTAGGGAA

GGGTGGGATAAAAGACTTCAGAACTCAGAGTTGTTAGCTCAGTGGACC
Translation
 - UNI30748 - MQMSYL KSKEQGYGKLSSDEDLEIIVDQKQ LVNEQQESRPLLSPSIDDFLCETKSEAIAKPVTSNTAV VLTTGLDLLDLSEPV

SQTQTKAKKSEPSSKSSSLKKKADGSDLISADAEQRAQALRGPETSSLDLV VDIQTQLEKWDDVKFHGDRTSKGHLMAERKSCSSRTGSKELLW WSAE

HRSQPELSTGKSALNSESASELELVAPAQ ARLTKEHRWGSALLSRNHSLEEEFERAKAAVE SDTEFWDKMQAEWEEMARRNWISENQEAQNQVTVSAS

EK GYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAE AWQFLGITQAENENEQAAIVALQR RCLELQPNNLKALMALAVSYTNT

SHQQDACEALKNWIKQNPKYKYLVKNKKGSPGLTRRMSKSPVDS SSVLEGVKELYLEAAHQNGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRP

E DYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYR REAVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIALSLMD

QPELFQAANLGDLDVLLRAFNLDP
Transcript ENSMUST00000078226
Sequence
CTCCTCTGACTGATGTGCAAGGTCTTGCAGAAGCCAGGGACTTGCATTCTGGGCTTGGCAAAGTGCTTAGGAAGACGACAGGGCTTCCCGGCTGGGAGGA

GGGAGGAGAGAGGAGAGCTGAAGATCCCCGCCTGGGCTGGCTCAGCTAAGCAAAGTGGGCAGCTCAGTACTTGAAAGAGGACTGTGCTCACTCGCTCGCT

CGCACTAGATATCA - UNI30748 - ATCTGTGGTTCTCTGGTCAGCAAGTTCTGGCAATGAAGCCACTGCCGCTGGTGCAAAGAATTCTGGGATGTC

TGACAGTGAAATGGATGGAAGGACTCACATTCCATCTCTACTTAATGCCCTTTTGTCCAGAAATCGGGTCATGCAGATGAGCTACTTG AAAAGTAAAGA

ACAAGGCTATGGCAAGCTAAGCAGTGACGAGGACCTGGAAATAATTGTTGACCAGAAGCAG CTGGTGAATGAGCAACAAGAGAGCAGACCCCTCCTGAG

CCCCTCCATCGACGACTTCCTCTGCGAAACCAAATCGGAGGCCATTGCAAAGCCAGTGACATCCAACACAGCCG TGTTGACCACTGGCTTGGATCTCCT

TGACCTGAGTGAACCCGTCTCTCAAACCCAAACCAAAGCCAAGAAATCTGAGCCCTCATCAAAGAGCTCGTCCCTCAAGAAGAAAGCTGATGGCTCCGAC

CTCATCAGTGCAGATGCTGAGCAGAGAGCACAGGCTCTCCGAGGGCCAGAGACATCATCCTTAGATTTAG ACATTCAAACACAACTGGAAAAATGGGAT

GATGTCAAGTTTCACGGTGACCGAACAAGCAAGGGGCATCTCATGGCAGAAAGGAAATCATGCTCTTCCAGAACTGGGTCCAAAGAGCTTCTTTG GTCC

GCAGAACACAGATCTCAGCCAGAGCTGAGTACTGGGAAAAGCGCCCTCAACTCTGAGTCGGCTTCCGAGTTGGAACTTGTAGCTCCAGCACAG GCTCGG

CTGACCAAAGAGCATCGCTGGGGAAGTGCCCTGCTCTCCAGGAACCATTCCTTGGAAGAGGAGTTTGAAAGGGCAAAAGCGGCAGTAGAG TCAGATACA

GAGTTCTGGGATAAGATGCAGGCAGAATGGGAGGAAATGGCCCGGAGGAACTGGATATCCGAGAACCAGGAAGCTCAGAACCAAGTCACCGTCTCGGCCA

GTGAGAAG GGATATTACTTCCACACTGAAAATCCCTTCAAGGACTGGCCTGGAGCATTTGAAGAAGGCTTAAAAAGGTTGAAGGAAGGGGACCTGCCTG

TCACCATCCTGTTCATGGAAGCTGCAATTCTTCAGGACCCTGGAGACGCTGAG GCATGGCAGTTTCTTGGTATAACCCAGGCTGAGAATGAAAATGAGC

AGGCAGCTATTGTCGCCCTCCAGAG GTGCCTGGAGTTGCAGCCCAACAACTTGAAGGCTCTGATGGCCTTGGCTGTAAGTTACACCAACACCAGCCACC

AGCAGGATGCTTGTGAGGCACTGAAGAACTGGATTAAGCAAAACCCAAAGTACAAGTACCTTGTGAAGAACAAGAAAGGCTCTCCAGGCCTCACACGGCG

GATGTCTAAATCCCCAGTTGACAG CTCTGTTCTGGAAGGAGTGAAGGAGTTGTACCTGGAAGCTGCCCACCAAAATGGTGACATGATTGACCCAGACCT

GCAGACAGGTCTGGGAGTTCTGTTCCACCTGAGTGGAGAGTTCAATAGAGCAATCGATGCATTTAATGCTGCCTTAACAGTTCGGCCAGAG GATTACTC

ACTGTGGAACCGTCTTGGGGCAACCTTGGCAAATGGAGACCGCAGTGAGGAAGCTGTGGAGGCCTACACGAGAGCACTGGAGATCCAGCCAGGTTTCATC

CGCTCCAGATACAACCTGGGGATCAGCTGCATCAACCTGGGTGCCTACAG AGAAGCGGTCAGCAACTTCCTCACTGCCCTCAGCTTGCAGAGGAAGAGC

AGGAACCAGCAGCAAGTCCCTCACCCTGCCATCTCCGGGAACATCTGGGCCGCCCTCAGGATTGCCCTGTCGCTGATGGACCAGCCGGAGCTCTTCCAGG

CCGCCAACCTCGGTGACTTGGATGTCCTCCTGAGAGCTTTCAATTTGGATCCTTGAAGGAAAAGAAGACAAGAATAATAAAGGATACTAATGTGTCTTCT

GTGTTATTATACT
Translation
 - UNI30748 - MSDSEMDGRTHIPSLLNALLSRNRVMQMSYL KSKEQGYGKLSSDEDLEIIVDQKQ LVNEQQESRPLLSPSIDDFLCETKSEAIA

KPVTSNTAV VLTTGLDLLDLSEPVSQTQTKAKKSEPSSKSSSLKKKADGSDLISADAEQRAQALRGPETSSLDLD DIQTQLEKWDDVKFHGDRTSKGH

LMAERKSCSSRTGSKELLW WSAEHRSQPELSTGKSALNSESASELELVAPAQ ARLTKEHRWGSALLSRNHSLEEEFERAKAAVE SDTEFWDKMQAEW

EEMARRNWISENQEAQNQVTVSASEK GYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAE AWQFLGITQAENENEQAAIVALQR

 RCLELQPNNLKALMALAVSYTNTSHQQDACEALKNWIKQNPKYKYLVKNKKGSPGLTRRMSKSPVDS SSVLEGVKELYLEAAHQNGDMIDPDLQTGLG

VLFHLSGEFNRAIDAFNAALTVRPE DYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYR REAVSNFLTALSLQRKSRNQ

QQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRAFNLDP
Transcript ENSMUST00000108225
Sequence
CTCCTCTGACTGATGTGCAAGGTCTTGCAGAAGCCAGGGACTTGCATTCTGGGCTTGGCAAAGTGCTTAGGAAGACGACAGGGCTTCCCGGCTGGGAGGA

GGGAGGAGAGAGGAGAGCTGAAGATCCCCGCCTGGGCTGGCTCAGCTAAGCAAAGTGGGCAGCTCAGTACTTGAAAGAGGACTGTGCTCACTCGCTCGCT

CGCACTAGATATCA - UNI30748 - ATCTGTGGTTCTCTGGTCAGCAAGTTCTGGCAATGAAGCCACTGCCGCTGGTGCAAAGAATTCTGGGATGTC

TGACAGTGAAATGGATGGAAGGACTCACATTCCATCTCTACTTAATGCCCTTTTGTCCAGAAATCGGGTCATGCAGATGAGCTACTTG AAAAGTAAAGA

ACAAGGCTATGGCAAGCTAAGCAGTGACGAGGACCTGGAAATAATTGTTGACCAGAAGCAG CTGGTGAATGAGCAACAAGAGAGCAGACCCCTCCTGAG

CCCCTCCATCGACGACTTCCTCTGCGAAACCAAATCGGAGGCCATTGCAAAGCCAGTGACATCCAACACAGCCG TGTTGACCACTGGCTTGGATCTCCT

TGACCTGAGTGAACCCGTCTCTCAAACCCAAACCAAAGCCAAGAAATCTGAGCCCTCATCAAAGAGCTCGTCCCTCAAGAAGAAAGCTGATGGCTCCGAC

CTCATCAGTGCAGATGCTGAGCAGAGAGCACAGGCTCTCCGAGGGCCAGAGACATCATCCTTAGATTTAG ACATTCAAACACAACTGGAAAAATGGGAT

GATGTCAAGTTTCACGGTGACCGAACAAGCAAGGGGCATCTCATGGCAGAAAGGAAATCATGCTCTTCCAGAACTGGGTCCAAAGAGCTTCTTTG GTCC

GCAGAACACAGATCTCAGCCAGAGCTGAGTACTGGGAAAAGCGCCCTCAACTCTGAGTCGGCTTCCGAGTTGGAACTTGTAGCTCCAGCACAG GCTCGG

CTGACCAAAGAGCATCGCTGGGGAAGTGCCCTGCTCTCCAGGAACCATTCCTTGGAAGAGGAGTTTGAAAGGGCAAAAGCGGCAGTAGAG TCAGATACA

GAGTTCTGGGATAAGATGCAGGCAGAATGGGAGGAAATGGCCCGGAGGAACTGGATATCCGAGAACCAGGAAGCTCAGAACCAAGTCACCGTCTCGGCCA

GTGAGAAG GGATATTACTTCCACACTGAAAATCCCTTCAAGGACTGGCCTGGAGCATTTGAAGAAGGCTTAAAAAGGTTGAAGGAAGGGGACCTGCCTG

TCACCATCCTGTTCATGGAAGCTGCAATTCTTCAGGACCCTGGAGACGCTGAG GCATGGCAGTTTCTTGGTATAACCCAGGCTGAGAATGAAAATGAGC

AGGCAGCTATTGTCGCCCTCCAGAG GTGCCTGGAGTTGCAGCCCAACAACTTGAAGGCTCTGATGGCCTTGGCTGTAAGTTACACCAACACCAGCCACC

AGCAGGATGCTTGTGAGGCACTGAAGAACTGGATTAAGCAAAACCCAAAGTACAAGTACCTTGTGAAGAACAAGAAAGGCTCTCCAGGCCTCACACGGCG

GATGTCTAAATCCCCAGTTGACAG CTCTGTTCTGGAAGGAGTGAAGGAGTTGTACCTGGAAGCTGCCCACCAAAATGGTGACATGATTGACCCAGACCT

GCAGACAGGTCTGGGAGTTCTGTTCCACCTGAGTGGAGAGTTCAATAGAGCAATCGATGCATTTAATGCTGCCTTAACAGTTCGGCCAGAG GATTACTC

ACTGTGGAACCGTCTTGGGGCAACCTTGGCAAATGGAGACCGCAGTGAGGAAGCTGTGGAGGCCTACACGAGAGCACTGGAGATCCAGCCAGGTTTCATC

CGCTCCAGATACAACCTGGGGATCAGCTGCATCAACCTGGGTGCCTACAG AGAAGCGGTCAGCAACTTCCTCACTGCCCTCAGCTTGCAGAGGAAGAGC

AGGAACCAGCAGCAAGTCCCTCACCCTGCCATCTCCGGGAACATCTGGGCCGCCCTCAGGATTGCCCTGTCGCTGATGGACCAGCCGGAGCTCTTCCAGG

CCGCCAACCTCGGTGACTTGGATGTCCTCCTGAGAGCTTTCAATTTGGATCCTTGAAGGAAAAGAAGACAAGAATAATAAAGGATACTAATGTGTCTTCT

GTGTTATTATACT
Translation
AKWAAQYLKEDCAHSLARTRYQ - UNI30748 - QSVVLWSASSGNEATAAGAKNSGMSDSEMDGRTHIPSLLNALLSRNRVMQMSYL KSKEQGYGK

LSSDEDLEIIVDQKQ LVNEQQESRPLLSPSIDDFLCETKSEAIAKPVTSNTAV VLTTGLDLLDLSEPVSQTQTKAKKSEPSSKSSSLKKKADGSDLIS

ADAEQRAQALRGPETSSLDLD DIQTQLEKWDDVKFHGDRTSKGHLMAERKSCSSRTGSKELLW WSAEHRSQPELSTGKSALNSESASELELVAPAQ A

RLTKEHRWGSALLSRNHSLEEEFERAKAAVE SDTEFWDKMQAEWEEMARRNWISENQEAQNQVTVSASEK GYYFHTENPFKDWPGAFEEGLKRLKEGD

LPVTILFMEAAILQDPGDAE AWQFLGITQAENENEQAAIVALQR RCLELQPNNLKALMALAVSYTNTSHQQDACEALKNWIKQNPKYKYLVKNKKGSP

GLTRRMSKSPVDS SSVLEGVKELYLEAAHQNGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPE DYSLWNRLGATLANGDRSEEAVEAYTRAL

EIQPGFIRSRYNLGISCINLGAYR REAVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRAFNLDP
Transcript ENSMUST00000108226
Sequence
GTCCCCGTGCCCGCGCGCGCTCAGCACCCGCGTGGAGGACAGCTCCGCAGCGCGCCGCTCGCCCAGCCGCCCTCTCGCCCGCCGGCGTCCTGTAGCCCGT

AGCCCGGGCGCCCCGCGGAGAGCCCGCGCCGCGCTGCCCGACCCGCAACTCTCTACGAGCTAGCTCGGGAGAGCAGCCATCAGCCTCGGGTGCCCTGAGG

ACGCCGGAGCAGAATGTACCAGGGACACATGCAG - UNI30748 - CTGGTGAATGAGCAACAAGAGAGCAGACCCCTCCTGAGCCCCTCCATCGACG

ACTTCCTCTGCGAAACCAAATCGGAGGCCATTGCAAAGCCAGTGACATCCAACACAGCCG TGTTGACCACTGGCTTGGATCTCCTTGACCTGAGTGAAC

CCGTCTCTCAAACCCAAACCAAAGCCAAGAAATCTGAGCCCTCATCAAAGAGCTCGTCCCTCAAGAAGAAAGCTGATGGCTCCGACCTCATCAGTGCAGA

TGCTGAGCAGAGAGCACAGGCTCTCCGAGGGCCAGAGACATCATCCTTAGATTTAG ACATTCAAACACAACTGGAAAAATGGGATGATGTCAAGTTTCA

CGGTGACCGAACAAGCAAGGGGCATCTCATGGCAGAAAGGAAATCATGCTCTTCCAGAACTGGGTCCAAAGAGCTTCTTTG GTCCGCAGAACACAGATC

TCAGCCAGAGCTGAGTACTGGGAAAAGCGCCCTCAACTCTGAGTCGGCTTCCGAGTTGGAACTTGTAGCTCCAGCACAG GCTCGGCTGACCAAAGAGCA

TCGCTGGGGAAGTGCCCTGCTCTCCAGGAACCATTCCTTGGAAGAGGAGTTTGAAAGGGCAAAAGCGGCAGTAGAG TCAGATACAGAGTTCTGGGATAA

GATGCAGGCAGAATGGGAGGAAATGGCCCGGAGGAACTGGATATCCGAGAACCAGGAAGCTCAGAACCAAGTCACCGTCTCGGCCAGTGAGAAG GGATA

TTACTTCCACACTGAAAATCCCTTCAAGGACTGGCCTGGAGCATTTGAAGAAGGCTTAAAAAGGTTGAAGGAAGGGGACCTGCCTGTCACCATCCTGTTC

ATGGAAGCTGCAATTCTTCAGGACCCTGGAGACGCTGAG GCATGGCAGTTTCTTGGTATAACCCAGGCTGAGAATGAAAATGAGCAGGCAGCTATTGTC

GCCCTCCAGAG GTGCCTGGAGTTGCAGCCCAACAACTTGAAGGCTCTGATGGCCTTGGCTGTAAGTTACACCAACACCAGCCACCAGCAGGATGCTTGT

GAGGCACTGAAGAACTGGATTAAGCAAAACCCAAAGTACAAGTACCTTGTGAAGAACAAGAAAGGCTCTCCAGGCCTCACACGGCGGATGTCTAAATCCC

CAGTTGACAG CTCTGTTCTGGAAGGAGTGAAGGAGTTGTACCTGGAAGCTGCCCACCAAAATGGTGACATGATTGACCCAGACCTGCAGACAGGTCTGG

GAGTTCTGTTCCACCTGAGTGGAGAGTTCAATAGAGCAATCGATGCATTTAATGCTGCCTTAACAGTTCGGCCAGAG GATTACTCACTGTGGAACCGTC

TTGGGGCAACCTTGGCAAATGGAGACCGCAGTGAGGAAGCTGTGGAGGCCTACACGAGAGCACTGGAGATCCAGCCAGGTTTCATCCGCTCCAGATACAA

CCTGGGGATCAGCTGCATCAACCTGGGTGCCTACAG AGAAGCGGTCAGCAACTTCCTCACTGCCCTCAGCTTGCAGAGGAAGAGCAGGAACCAGCAGCA

AGTCCCTCACCCTGCCATCTCCGGGAACATCTGGGCCGCCCTCAGGATTGCCCTGTCGCTGATGGACCAGCCGGAGCTCTTCCAGGCCGCCAACCTCGGT

GACTTGGATGTCCTCCTGAGAGCTTTCAATTTGGATCCTTGAAGGAAAAGAAGACAAGAATAATAAAGGATACTAATGTGTCTTCTGTGTTATTATACTA

AAAAGGGACAAAACTATTTTATTATGAATTTCCAAAACACATTTTTTTTAAAAAAGGATAAAGCTGAGAGGCAAAAGGCCATGGTCATATAAGCCAAGGG

AATTGATTTCTACAGATCCAGTCTCTGTTCAGACCCAAAAGCACAAAGCGAAGGTCGGGGTCAAGAGAAGAACTGAGATTCTCAGGACAAACCAAGATAA

GGTAACTGCACTCGCTTCCAAATTGCAAGTGTACTTTGAGTTATATTGTTCCTGTCCCAGCTGGTGGCACATCTGAGGGACACTCTTGGGACATAACATG

ACAATTTGTCCACAGTCAGTGAACTCAGGCTGTCTTTGTCTACCCTTTTGCAAGACTGAACATAGTTTGGGCCACTGGCAAATGTACACATGCAGCCATT

GCTTCCCTCTCGCCCACTCTAACCTTGACTGTAAGCCTTTGTTTTCAGAGACAGAGAGCTTTGCTGGCGAAAGCAGTTTTTGCACTAGAAGTTTTTGCTG

TTCCCAATGAAATCCTTTCTAGGATTGTACATAAGCACTTTAATATCTTATTTATGCCTTGCCGGGCTTCTGGCTTGCTGCTCCAGTTTCTAACTTGGGG

GGTAGGGAAGGGTGGGATAAAAGACTTCAGAACTCAGAGTTGTTAGCTCAGTGGACC
Translation
MYQGHMQ - UNI30748 - LVNEQQESRPLLSPSIDDFLCETKSEAIAKPVTSNTAV VLTTGLDLLDLSEPVSQTQTKAKKSEPSSKSSSLKKKADG

SDLISADAEQRAQALRGPETSSLDLD DIQTQLEKWDDVKFHGDRTSKGHLMAERKSCSSRTGSKELLW WSAEHRSQPELSTGKSALNSESASELELVA

PAQ ARLTKEHRWGSALLSRNHSLEEEFERAKAAVE SDTEFWDKMQAEWEEMARRNWISENQEAQNQVTVSASEK GYYFHTENPFKDWPGAFEEGLKR

LKEGDLPVTILFMEAAILQDPGDAE AWQFLGITQAENENEQAAIVALQR RCLELQPNNLKALMALAVSYTNTSHQQDACEALKNWIKQNPKYKYLVKN

KKGSPGLTRRMSKSPVDS SSVLEGVKELYLEAAHQNGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPE DYSLWNRLGATLANGDRSEEAVEA

YTRALEIQPGFIRSRYNLGISCINLGAYR REAVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRAFNLDP

For any suggestions or comments, please send an email to unitrap@crg.es