Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027680 (Fxr1)
Chromosomal location
Chr 3: 33919030 - 33968259 (+)
Description
fragile X mental retardation gene 1, autosomal homolog Gene [Source:MGI Symbol;Acc:MGI:104860]
RefSeq_peptide
NP_001106660.1 NP_032079.1 NP_001106659.1 
MGI
MGI:104860 
Uniprot/SWISSPROT
Q61584 
Uniprot/SPTREMBL
Q8C7U4 
Human Ortholog
ENSG00000114416 (FXR1)
Omim not available
UniTrap UNI2391
Vector Insertion
Chr 3: 33919086 - 33938448
Public Clones (sanger) AD0074 (sanger) AE0298 (sanger) RRZ363 (baygenomics) XST020 (baygenomics)
E056G02 (ggtc) D039G02 (ggtc) D022B09 (ggtc) D033B05 (ggtc) M121B07 (ggtc)
P119E01 (ggtc) E068G11 (ggtc) D115F10 (ggtc) D035E08 (ggtc) D014C03 (ggtc)
W271A01 (ggtc) E059C06 (ggtc) D051C11 (ggtc) D029D11 (ggtc) H008G06 (ggtc)
D016E06 (ggtc) E019A03 (ggtc) D037C12 (ggtc) P004A04 (ggtc) H004D05 (ggtc)
D107A09 (ggtc) D047C06 (ggtc) W212E01 (ggtc) P028C03 (ggtc) E112A03 (ggtc)
P064F09 (ggtc) CMHD-GT_320C10-3 (cmhd) CMHD-GT_320G3-3 (cmhd) CMHD-GT_364B4-3 (cmhd)
CMHD-GT_320C9-3 (cmhd) IST11189H3 (tigm) IST14209D11 (tigm) IST14519C4 (tigm)
IST14218D9 (tigm) IST14201D8 (tigm) IST14132C11 (tigm) IST14874D9 (tigm)
IST14440A3 (tigm) IST14393F11 (tigm) IST14338D7 (tigm)
Private Clones OST499959 (lexicon) OST470093 (lexicon) OST469414 (lexicon) OST468260 (lexicon)
OST467959 (lexicon) OST464942 (lexicon) OST461101 (lexicon) OST451729 (lexicon)
OST445181 (lexicon) OST439120 (lexicon) OST432844 (lexicon) OST429561 (lexicon)
OST425239 (lexicon) OST425199 (lexicon) OST417574 (lexicon) OST413968 (lexicon)
OST409137 (lexicon) OST362333 (lexicon) OST361227 (lexicon) OST360207 (lexicon)
OST351348 (lexicon) OST345959 (lexicon) OST335078 (lexicon) OST333681 (lexicon)
OST321767 (lexicon) OST317034 (lexicon) OST315513 (lexicon) OST314234 (lexicon)
OST308354 (lexicon) OST306362 (lexicon) OST305504 (lexicon) OST303632 (lexicon)
OST300878 (lexicon) OST290995 (lexicon) OST289997 (lexicon) OST289832 (lexicon)
OST285523 (lexicon) OST284966 (lexicon) OST280167 (lexicon) OST276005 (lexicon)
OST266575 (lexicon) OST254568 (lexicon) OST246658 (lexicon) OST245964 (lexicon)
OST245241 (lexicon) OST242403 (lexicon) OST241491 (lexicon) OST239256 (lexicon)
OST234573 (lexicon) OST222824 (lexicon) OST222407 (lexicon) OST219546 (lexicon)
OST219251 (lexicon) OST212604 (lexicon) OST212537 (lexicon) OST211806 (lexicon)
OST208289 (lexicon) OST201152 (lexicon) OST182957 (lexicon) OST175794 (lexicon)
OST175554 (lexicon) OST166977 (lexicon) OST151372 (lexicon) OST136621 (lexicon)
OST136193 (lexicon) OST132618 (lexicon) OST110404 (lexicon) OST109721 (lexicon)
OST109227 (lexicon) OST105180 (lexicon) OST90486 (lexicon) OST71799 (lexicon)
OST68334 (lexicon) OST67237 (lexicon) OST63305 (lexicon) OST63201 (lexicon)
OST51789 (lexicon) OST47491 (lexicon) OST43147 (lexicon) OST35688 (lexicon)
OST35120 (lexicon) OST34610 (lexicon) OST34417 (lexicon) OST34234 (lexicon)
OST30268 (lexicon) OST7179 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11974
Vector Insertion
Chr 3: 33938502 - 33939984
Public Clones D107A09 (ggtc) P013G10 (ggtc) D054F11 (ggtc) M008E02 (ggtc)
Private Clones OST464221 (lexicon) OST446424 (lexicon) OST432497 (lexicon) OST415114 (lexicon)
OST383680 (lexicon) OST379341 (lexicon) OST373637 (lexicon) OST364232 (lexicon)
OST362155 (lexicon) OST354315 (lexicon) OST331143 (lexicon) OST328695 (lexicon)
OST299432 (lexicon) OST297004 (lexicon) OST262974 (lexicon) OST234584 (lexicon)
OST232867 (lexicon) OST230567 (lexicon) OST209867 (lexicon) OST205252 (lexicon)
OST196381 (lexicon) OST195215 (lexicon) OST112089 (lexicon) OST65798 (lexicon)
OST37573 (lexicon) OST36299 (lexicon) OST36026 (lexicon) OST35429 (lexicon)
OST35280 (lexicon) OST34775 (lexicon) OST34746 (lexicon) OST34726 (lexicon)
OST34704 (lexicon) OST34698 (lexicon) OST34688 (lexicon) OST34683 (lexicon)
OST34677 (lexicon) OST34671 (lexicon) OST34654 (lexicon) OST34651 (lexicon)
OST34649 (lexicon) OST34648 (lexicon) OST34627 (lexicon) OST34625 (lexicon)
OST34590 (lexicon) OST34266 (lexicon) OST34265 (lexicon) OST34241 (lexicon)
OST33603 (lexicon) OST33229 (lexicon) OST33199 (lexicon) OST33180 (lexicon)
OST33148 (lexicon) OST33133 (lexicon) OST32478 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12991
Vector Insertion
Chr 3: 33940079 - 33944953
Public Clones (ggtc) CMHD-GT_354D10-3 (cmhd) IST15022E12 (tigm) IST12127C5 (tigm)
Private Clones OST218837 (lexicon) OST194901 (lexicon) OST177689 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24156
Vector Insertion
Chr 3: 33945026 - 33945358
Public Clones not available
Private Clones OST232630 (lexicon) OST211807 (lexicon) OST9136 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21434
Vector Insertion
Chr 3: 33946671 - 33948074
Public Clones not available
Private Clones OST330158 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20074
Vector Insertion
Chr 3: 33963040 - 33963242
Public Clones not available
Private Clones OST373704 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28632
Vector Insertion
Chr 3: 33967175 - 33967838
Public Clones CMHD-GT_457E2-3 (cmhd)
Private Clones OST24911 (lexicon) OST21961 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091244
Sequence
CCAACATGGCGGAGCTGACGGTGGAGGTTCGCGGCTCCAACGGGGCTTTCTACAAG - UNI2391 - GGATTTATCAAAGATGTCCACGAAGACTCCC

TCACAGTTGTTTTTGAAAATAA - UNI11974 - TTGGCAACCAGAACGCCAGGTTCCGTTTAATGAAGTGCGATTACCACCACCACCTGATATAAAA

AAAGAAATTAGTGAAGGAGATGAAGTAGAG - UNI12991 - GTATATTCAAGAGCAAATGACCAAGAGCCATGTGGATGGTGGCTGGCTAAAGTTCG

GATGATGAAAGGCGAG - UNI24156 - TTTTATGTCATTGAATATGCTGCTTGTGATGCCACTTACAATGAAATAGTCACATTTGAACGACTTCGGC

CTGTCAATCAAAATAAAACTGTCAAAAAAAATACCTTCTTTAAGTGCACAGTGGATGTTCCTGAGGACCTGAGAGAAGC GTGTGCTAATGAAAATGCCC

ATAAAGATTTTAAGAAAGCAGTAGGAGCATGCAGAATCTTTTATCATCCTGAAACTACCCAGCTAATGATACTG TCGGCCAGTGAAGCAACTGTGAAGA

GAGTAAATATCTTAAGTGATATGCATTTGAGAAGTATTCGGACGAAGTTGATGCTTATGTCCAGAAATGAAGAGGCCACTAAGCATTTAGAA - UNI21

434 - TGCACAAAACAACTTGCAGCAGCTTTTCATGAAGAATTTGTTGTGAGAGAAGATTTAATGGGCCTGGCGATAGGAACGCATGGCAGTAACATAC

AGCAAGCTAGGAAGGTTCCTGGAGTTACTGCCATTGAGTTAGATGAAGACACCGGAACGTTTAGAATCTATGGAGAG AGTGCTGAGGCTGTAAAAAAAG

CTAGAGGTTTCTTGGAATTTGTGGAAGATTTTATTCAAGTTCCCAGGAATCTTGTTG GAAAAGTAATTGGAAAAAATGGCAAAGTTATTCAAGAAATAG

TGGATAAATCTGGTGTGGTTCGAGTAAGAATTGAAGGAGACAATGAAAATAAACTACCTAGAGAAGAC GGAATGGTTCCATTTGTATTTGTTGGCACTA

AAGAAAGCATTGGGAATGTGCAAGTTCTTCTAGAGTATCACATCGCTTACTTAAAG GAAGTGGAACAACTAAGAATGGAACGTCTGCAGATTGATGAGC

AGCTGCGACAGATTG GTTCTAGGTCTTATAGTGGAAGAGGCAGAGGTCGTCGGGGCCCTAATTACACCTCCGGTTATG GTACAAATTCTGAGCTGTCT

AACCCCTCCGAAACAGAATCTGAGCGTAAAGATGAGCTGAGTGATTGGTCATTGGCAGGAGAAGATGATCGAGAGACTCGACATCAGCGAGACAGCAGGA

GACGCCCAGGAGGAAGAGGCAGAAGTGTTTCTGGGGGACGAGGTCGTGGTGGACCACGTGGTGGCAAATCCTCCATCAGTTCTG - UNI20074 - TG

CTCAAAGATCCAGACAGCAATCCATACAGCTTACTTGATAATACAGAATCCGATCAGACTGCAGACACTGACGCCAGCGAATCTCACCACAGTACTAACC

GTCGTAGGCGGTCTCGTAGACGGAGGACTGATGAAGATGCTGTTCTGATGGATGGACTGACTGAATCTGATACAGCCTCAGTTAATGAGAATGGGCTAGG

TAT ACAATGTGAC
Translation
MAELTVEVRGSNGAFYK - UNI2391 - GFIKDVHEDSLTVVFENN - UNI11974 - NWQPERQVPFNEVRLPPPPDIKKEISEGDEVE - UNI

12991 - VYSRANDQEPCGWWLAKVRMMKGE - UNI24156 - FYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREA ACA

NENAHKDFKKAVGACRIFYHPETTQLMIL SASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLE - UNI21434 - CTKQLAAAFHEEFVVRE

DLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGE SAEAVKKARGFLEFVEDFIQVPRNLVG GKVIGKNGKVIQEIVDKSGVVRVRIEGDNEN

KLPRED GMVPFVFVGTKESIGNVQVLLEYHIAYLK EVEQLRMERLQIDEQLRQIG GSRSYSGRGRGRRGPNYTSGYG GTNSELSNPSETESERKDE

LSDWSLAGEDDRETRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSV - UNI20074 - VLKDPDSNPYSLLDNTESDQTADTDASESHHSTNRR

RRSRRRRTDEDAVLMDGLTESDTASVNENGLGI IQCD
Transcript ENSMUST00000108197
Sequence
CCAACATGGCGGAGCTGACGGTGGAGGTTCGCGGCTCCAACGGGGCTTTCTACAAG - UNI2391 - GGATTTATCAAAGATGTCCACGAAGACTCCC

TCACAGTTGTTTTTGAAAATAA - UNI11974 - TTGGCAACCAGAACGCCAGGTTCCGTTTAATGAAGTGCGATTACCACCACCACCTGATATAAAA

AAAGAAATTAGTGAAGGAGATGAAGTAGAG - UNI12991 - GTATATTCAAGAGCAAATGACCAAGAGCCATGTGGATGGTGGCTGGCTAAAGTTCG

GATGATGAAAGGCGAG - UNI24156 - TTTTATGTCATTGAATATGCTGCTTGTGATGCCACTTACAATGAAATAGTCACATTTGAACGACTTCGGC

CTGTCAATCAAAATAAAACTGTCAAAAAAAATACCTTCTTTAAGTGCACAGTGGATGTTCCTGAGGACCTGAGAGAAGC GTGTGCTAATGAAAATGCCC

ATAAAGATTTTAAGAAAGCAGTAGGAGCATGCAGAATCTTTTATCATCCTGAAACTACCCAGCTAATGATACTG TCGGCCAGTGAAGCAACTGTGAAGA

GAGTAAATATCTTAAGTGATATGCATTTGAGAAGTATTCGGACGAAGTTGATGCTTATGTCCAGAAATGAAGAGGCCACTAAGCATTTAGAA - UNI21

434 - TGCACAAAACAACTTGCAGCAGCTTTTCATGAAGAATTTGTTGTGAGAGAAGATTTAATGGGCCTGGCGATAGGAACGCATGGCAGTAACATAC

AGCAAGCTAGGAAGGTTCCTGGAGTTACTGCCATTGAGTTAGATGAAGACACCGGAACGTTTAGAATCTATGGAGAG AGTGCTGAGGCTGTAAAAAAAG

CTAGAGGTTTCTTGGAATTTGTGGAAGATTTTATTCAAGTTCCCAGGAATCTTGTTG GAAAAGTAATTGGAAAAAATGGCAAAGTTATTCAAGAAATAG

TGGATAAATCTGGTGTGGTTCGAGTAAGAATTGAAGGAGACAATGAAAATAAACTACCTAGAGAAGAC GGAATGGTTCCATTTGTATTTGTTGGCACTA

AAGAAAGCATTGGGAATGTGCAAGTTCTTCTAGAGTATCACATCGCTTACTTAAAG GAAGTGGAACAACTAAGAATGGAACGTCTGCAGATTGATGAGC

AGCTGCGACAGATTG GTTCTAGGTCTTATAGTGGAAGAGGCAGAGGTCGTCGGGGCCCTAATTACACCTCCGGTTATG GTACAAATTCTGAGCTGTCT

AACCCCTCCGAAACAGAATCTGAGCGTAAAGATGAGCTGAGTGATTGGTCATTGGCAGGAGAAGATGATCGAGAGACTCGACATCAGCGAGACAGCAGGA

GACGCCCAGGAGGAAGAGGCAGAAGTGTTTCTGGGGGACGAGGTCGTGGTGGACCACGTGGTGGCAAATCCTCCATCAGTTCTG - UNI20074 - TG

CTCAAAGATCCAGACAGCAATCCATACAGCTTACTTGATAATACAGAATCCGATCAGACTGCAGACACTGACGCCAGCGAATCTCACCACAGTACTAACC

GTCGTAGGCGGTCTCGTAGACGGAGGACTGATGAAGATGCTGTTCTGATGGATGGACTGACTGAATCTGATACAGCCTCAGTTAATGAGAATGGGCTAG 

- UNI20074 - ATGATAGTGAAAAAAAACCCCAGCGACGCAATCGTAGCCGCAGGCGTCGTTTCAGGGGTCAGGCAGAAGATAGACAGCCAG TCACA

GTTGCAGATTATATTTCTAGAGCTGAGTCTCAGAGCAGACAAAGAAACCTCCCAAGGGAAACTTTGGCTAAAAACAAGAAAGAAATG - UNI28632 -

 GCAAAAGATGTGATTGAAGAGCATGGTCCTTCAGAAAAGGCAATAAATGGTCCAACTAGCGCTTCTGGCGATGAAATTCCTAAGCTACCGCGTACTCTG

GGAGAAGAAAAGACTAAGACCTTAAAAGAAGACAGCACTCAAGAAGCAGCAGTCCTGAATGGTGTTTCATAACTGAAGGAAGTTCCTAGTTTACAGTTCT

TTTACATTACAGTTACAATAGTGCTTGTACAAGCTTGCCAAAGATAGAATACGGATCGCCAGTCTTACATCGCACTTTCAGTTCCTCCATTTGGAATTCA

GAAAGGGGAGGGATCCTGAAGAAATCATATGTTAAACATACTTTGACACCTACTGTGTTAAAAATATATCATCAGATGTGCCTTGAGAATAGTATATGTA

ACATTAAAAAAAGTTGCTGGCT
Translation
MAELTVEVRGSNGAFYK - UNI2391 - GFIKDVHEDSLTVVFENN - UNI11974 - NWQPERQVPFNEVRLPPPPDIKKEISEGDEVE - UNI

12991 - VYSRANDQEPCGWWLAKVRMMKGE - UNI24156 - FYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREA ACA

NENAHKDFKKAVGACRIFYHPETTQLMIL SASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLE - UNI21434 - CTKQLAAAFHEEFVVRE

DLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGE SAEAVKKARGFLEFVEDFIQVPRNLVG GKVIGKNGKVIQEIVDKSGVVRVRIEGDNEN

KLPRED GMVPFVFVGTKESIGNVQVLLEYHIAYLK EVEQLRMERLQIDEQLRQIG GSRSYSGRGRGRRGPNYTSGYG GTNSELSNPSETESERKDE

LSDWSLAGEDDRETRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSV - UNI20074 - VLKDPDSNPYSLLDNTESDQTADTDASESHHSTNRR

RRSRRRRTDEDAVLMDGLTESDTASVNENGLD - UNI20074 - DDSEKKPQRRNRSRRRRFRGQAEDRQPV VTVADYISRAESQSRQRNLPRETLA

KNKKEM - UNI28632 - AKDVIEEHGPSEKAINGPTSASGDEIPKLPRTLGEEKTKTLKEDSTQEAAVLNGVS
Transcript ENSMUST00000108198
Sequence
CCAACATGGCGGAGCTGACGGTGGAGGTTCGCGGCTCCAACGGGGCTTTCTACAAG - UNI2391 - GGATTTATCAAAGATGTCCACGAAGACTCCC

TCACAGTTGTTTTTGAAAATAA - UNI11974 - TTGGCAACCAGAACGCCAGGTTCCGTTTAATGAAGTGCGATTACCACCACCACCTGATATAAAA

AAAGAAATTAGTGAAGGAGATGAAGTAGAG - UNI12991 - GTATATTCAAGAGCAAATGACCAAGAGCCATGTGGATGGTGGCTGGCTAAAGTTCG

GATGATGAAAGGCGAG - UNI24156 - TTTTATGTCATTGAATATGCTGCTTGTGATGCCACTTACAATGAAATAGTCACATTTGAACGACTTCGGC

CTGTCAATCAAAATAAAACTGTCAAAAAAAATACCTTCTTTAAGTGCACAGTGGATGTTCCTGAGGACCTGAGAGAAGC GTGTGCTAATGAAAATGCCC

ATAAAGATTTTAAGAAAGCAGTAGGAGCATGCAGAATCTTTTATCATCCTGAAACTACCCAGCTAATGATACTG TCGGCCAGTGAAGCAACTGTGAAGA

GAGTAAATATCTTAAGTGATATGCATTTGAGAAGTATTCGGACGAAGTTGATGCTTATGTCCAGAAATGAAGAGGCCACTAAGCATTTAGAA - UNI21

434 - TGCACAAAACAACTTGCAGCAGCTTTTCATGAAGAATTTGTTGTGAGAGAAGATTTAATGGGCCTGGCGATAGGAACGCATGGCAGTAACATAC

AGCAAGCTAGGAAGGTTCCTGGAGTTACTGCCATTGAGTTAGATGAAGACACCGGAACGTTTAGAATCTATGGAGAG AGTGCTGAGGCTGTAAAAAAAG

CTAGAGGTTTCTTGGAATTTGTGGAAGATTTTATTCAAGTTCCCAGGAATCTTGTTG GAAAAGTAATTGGAAAAAATGGCAAAGTTATTCAAGAAATAG

TGGATAAATCTGGTGTGGTTCGAGTAAGAATTGAAGGAGACAATGAAAATAAACTACCTAGAGAAGAC GGAATGGTTCCATTTGTATTTGTTGGCACTA

AAGAAAGCATTGGGAATGTGCAAGTTCTTCTAGAGTATCACATCGCTTACTTAAAG GAAGTGGAACAACTAAGAATGGAACGTCTGCAGATTGATGAGC

AGCTGCGACAGATTGGTATGGGTTTCAGACCTTCTTCCACCAGAGGGCCTGAAAGAGAGAAAGGATATGCCACTGATGAAAGTACCGTCTCTTCTGTACA

AGGTTCTAGGTCTTATAGTGGAAGAGGCAGAGGTCGTCGGGGCCCTAATTACACCTCCGGTTATG GTACAAATTCTGAGCTGTCTAACCCCTCCGAAAC

AGAATCTGAGCGTAAAGATGAGCTGAGTGATTGGTCATTGGCAGGAGAAGATGATCGAGAGACTCGACATCAGCGAGACAGCAGGAGACGCCCAGGAGGA

AGAGGCAGAAGTGTTTCTGGGGGACGAGGTCGTGGTGGACCACGTGGTGGCAAATCCTCCATCAGTTCTG - UNI20074 - TGCTCAAAGATCCAGA

CAGCAATCCATACAGCTTACTTGATAATACAGAATCCGATCAGACTGCAGACACTGACGCCAGCGAATCTCACCACAGTACTAACCGTCGTAGGCGGTCT

CGTAGACGGAGGACTGATGAAGATGCTGTTCTGATGGATGGACTGACTGAATCTGATACAGCCTCAGTTAATGAGAATGGGCTAG - UNI20074 - T

CACAGTTGCAGATTATATTTCTAGAGCTGAGTCTCAGAGCAGACAAAGAAACCTCCCAAGGGAAACTTTGGCTAAAAACAAGAAAGAAATG - UNI286

32 - GCAAAAGATGTGATTGAAGAGCATGGTCCTTCAGAAAAGGCAATAAATGGTCCAACTAGCGCTTCTGGCGATGAAATTCCTAAGCTACCGCGTAC

TCTGGGAGAAGAAAAGACTAAGACCTTAAAAGAAGACAGCACTCAAGAAGCAGCAGTCCTGAATGGTGTTTCATAACTGAAGGAAGTTCCTAGTTTACAG

TTCTTTTACATTACAGTTACAATAGTGCTTGTACAAGCTTGCCAAAGATAGAATACGGATCGCCAGTCTTACATCGCACTTTCAGTTCCTCCATTTGGAA

TTCAGAAAGGGGAGGGATCCTGAAGAAATCATATGTTAAACATACTTTGACACCTACTGTGTTAAAAATATATCATCAGATGTGCCTTGAGAATAGTATA

TGTAACATTAAAAAAAGTTGCTGGCT
Translation
MAELTVEVRGSNGAFYK - UNI2391 - GFIKDVHEDSLTVVFENN - UNI11974 - NWQPERQVPFNEVRLPPPPDIKKEISEGDEVE - UNI

12991 - VYSRANDQEPCGWWLAKVRMMKGE - UNI24156 - FYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREA ACA

NENAHKDFKKAVGACRIFYHPETTQLMIL SASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLE - UNI21434 - CTKQLAAAFHEEFVVRE

DLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGE SAEAVKKARGFLEFVEDFIQVPRNLVG GKVIGKNGKVIQEIVDKSGVVRVRIEGDNEN

KLPRED GMVPFVFVGTKESIGNVQVLLEYHIAYLK EVEQLRMERLQIDEQLRQIGMGFRPSSTRGPEREKGYATDESTVSSVQGSRSYSGRGRGRRGP

NYTSGYG GTNSELSNPSETESERKDELSDWSLAGEDDRETRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSV - UNI20074 - VLKDPDSNP

YSLLDNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMDGLTESDTASVNENGLV - UNI20074 - VTVADYISRAESQSRQRNLPRETLAKN

KKEM - UNI28632 - AKDVIEEHGPSEKAINGPTSASGDEIPKLPRTLGEEKTKTLKEDSTQEAAVLNGVS
Transcript ENSMUST00000001620
Sequence
CCAACATGGCGGAGCTGACGGTGGAGGTTCGCGGCTCCAACGGGGCTTTCTACAAG - UNI2391 - GGATTTATCAAAGATGTCCACGAAGACTCCC

TCACAGTTGTTTTTGAAAATAA - UNI11974 - TTGGCAACCAGAACGCCAGGTTCCGTTTAATGAAGTGCGATTACCACCACCACCTGATATAAAA

AAAGAAATTAGTGAAGGAGATGAAGTAGAG - UNI12991 - GTATATTCAAGAGCAAATGACCAAGAGCCATGTGGATGGTGGCTGGCTAAAGTTCG

GATGATGAAAGGCGAG - UNI24156 - TTTTATGTCATTGAATATGCTGCTTGTGATGCCACTTACAATGAAATAGTCACATTTGAACGACTTCGGC

CTGTCAATCAAAATAAAACTGTCAAAAAAAATACCTTCTTTAAGTGCACAGTGGATGTTCCTGAGGACCTGAGAGAAGC GTGTGCTAATGAAAATGCCC

ATAAAGATTTTAAGAAAGCAGTAGGAGCATGCAGAATCTTTTATCATCCTGAAACTACCCAGCTAATGATACTG TCGGCCAGTGAAGCAACTGTGAAGA

GAGTAAATATCTTAAGTGATATGCATTTGAGAAGTATTCGGACGAAGTTGATGCTTATGTCCAGAAATGAAGAGGCCACTAAGCATTTAGAA - UNI21

434 - TGCACAAAACAACTTGCAGCAGCTTTTCATGAAGAATTTGTTGTGAGAGAAGATTTAATGGGCCTGGCGATAGGAACGCATGGCAGTAACATAC

AGCAAGCTAGGAAGGTTCCTGGAGTTACTGCCATTGAGTTAGATGAAGACACCGGAACGTTTAGAATCTATGGAGAG AGTGCTGAGGCTGTAAAAAAAG

CTAGAGGTTTCTTGGAATTTGTGGAAGATTTTATTCAAGTTCCCAGGAATCTTGTTG GAAAAGTAATTGGAAAAAATGGCAAAGTTATTCAAGAAATAG

TGGATAAATCTGGTGTGGTTCGAGTAAGAATTGAAGGAGACAATGAAAATAAACTACCTAGAGAAGAC GGAATGGTTCCATTTGTATTTGTTGGCACTA

AAGAAAGCATTGGGAATGTGCAAGTTCTTCTAGAGTATCACATCGCTTACTTAAAG GAAGTGGAACAACTAAGAATGGAACGTCTGCAGATTGATGAGC

AGCTGCGACAGATTGGTATGGGTTTCAGACCTTCTTCCACCAGAGGGCCTGAAAGAGAGAAAGGATATGCCACTGATGAAAGTACCGTCTCTTCTGTACA

AGGTTCTAGGTCTTATAGTGGAAGAGGCAGAGGTCGTCGGGGCCCTAATTACACCTCCGGTTATG GTACAAATTCTGAGCTGTCTAACCCCTCCGAAAC

AGAATCTGAGCGTAAAGATGAGCTGAGTGATTGGTCATTGGCAGGAGAAGATGATCGAGAGACTCGACATCAGCGAGACAGCAGGAGACGCCCAGGAGGA

AGAGGCAGAAGTGTTTCTGGGGGACGAGGTCGTGGTGGACCACGTGGTGGCAAATCCTCCATCAGTTCTG - UNI20074 - TGCTCAAAGATCCAGA

CAGCAATCCATACAGCTTACTTGATAATACAGAATCCGATCAGACTGCAGACACTGACGCCAGCGAATCTCACCACAGTACTAACCGTCGTAGGCGGTCT

CGTAGACGGAGGACTGATGAAGATGCTGTTCTGATGGATGGACTGACTGAATCTGATACAGCCTCAGTTAATGAGAATGGGCTAG - UNI20074 - A

TGATAGTGAAAAAAAACCCCAGCGACGCAATCGTAGCCGCAGGCGTCGTTTCAGGGGTCAGGCAGAAGATAGACAGCCAG TCACAGTTGCAGATTATAT

TTCTAGAGCTGAGTCTCAGAGCAGACAAAGAAACCTCCCAAGGGAAACTTTGGCTAAAAACAAGAAAGAAATG - UNI28632 - GCAAAAGATGTGA

TTGAAGAGCATGGTCCTTCAGAAAAGGCAATAAATGGTCCAACTAGCGCTTCTGGCGATGAAATTCCTAAGCTACCGCGTACTCTGGGAGAAGAAAAGAC

TAAGACCTTAAAAGAAGACAGCACTCAAGAAGCAGCAGTCCTGAATGGTGTTTCATAACTGAAGGAAGTTCCTAGTTTACAGTTCTTTTACATTACAGTT

ACAATAGTGCTTGTACAAGCTTGCCAAAGATAGAATACGGATCGCCAGTCTTACATCGCACTTTCAGTTCCTCCATTTGGAATTCAGAAAGGGGAGGGAT

CCTGAAGAAATCATATGTTAAACATACTTTGACACCTACTGTGTTAAAAATATATCATCAGATGTGCCTTGAGAATAGTATATGTAACATTAAAAAAAGT

TGCTGGCT
Translation
MAELTVEVRGSNGAFYK - UNI2391 - GFIKDVHEDSLTVVFENN - UNI11974 - NWQPERQVPFNEVRLPPPPDIKKEISEGDEVE - UNI

12991 - VYSRANDQEPCGWWLAKVRMMKGE - UNI24156 - FYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREA ACA

NENAHKDFKKAVGACRIFYHPETTQLMIL SASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLE - UNI21434 - CTKQLAAAFHEEFVVRE

DLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGE SAEAVKKARGFLEFVEDFIQVPRNLVG GKVIGKNGKVIQEIVDKSGVVRVRIEGDNEN

KLPRED GMVPFVFVGTKESIGNVQVLLEYHIAYLK EVEQLRMERLQIDEQLRQIGMGFRPSSTRGPEREKGYATDESTVSSVQGSRSYSGRGRGRRGP

NYTSGYG GTNSELSNPSETESERKDELSDWSLAGEDDRETRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSV - UNI20074 - VLKDPDSNP

YSLLDNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMDGLTESDTASVNENGLD - UNI20074 - DDSEKKPQRRNRSRRRRFRGQAEDRQP

V VTVADYISRAESQSRQRNLPRETLAKNKKEM - UNI28632 - AKDVIEEHGPSEKAINGPTSASGDEIPKLPRTLGEEKTKTLKEDSTQEAAVLN

GVS

For any suggestions or comments, please send an email to unitrap@crg.es