Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027703 (Lrriq4)
Chromosomal location
Chr 3: 30543429 - 30571353 (+)
Description
leucine-rich repeats and IQ motif containing 4 Gene [Source:MGI Symbol;Acc:MGI:1915557]
RefSeq_dna
NM_026668 
RefSeq_peptide
NP_080944.2 
UniGene
Mm.389425 
MGI
MGI:1915557 
Uniprot/SWISSPROT
A6H6A4 
Uniprot/SPTREMBL
Q9D2F4 
Human Ortholog
ENSG00000188306 (LRRIQ4)
Omim not available
UniTrap UNI32935
Vector Insertion
Chr 3: 30544271 - 30545174
Public Clones IST12045D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30698
Vector Insertion
Chr 3: 30545236 - 30547147
Public Clones (sanger) IST14384G1 (tigm) IST12241F7 (tigm) IST11440F5HMF1 (tigm) IST10656F12 (tigm)
IST12627C3 (tigm) IST10902H12 (tigm) IST14437B8 (tigm) IST14338H2 (tigm)
IST12401H2 (tigm) IST13129B5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20641
Vector Insertion
Chr 3: 30547183 - 30548826
Public Clones not available
Private Clones OST356001 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20725
Vector Insertion
Chr 3: 30549875 - 30554558
Public Clones IST11388H4 (tigm)
Private Clones OST353628 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14097
Vector Insertion
Chr 3: 30559020 - 30571062
Public Clones CMHD-GT_115A10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108265
Sequence
ATGGCCTATCCCAGTGCCAAGCTGCAGATGCACAG - UNI20641 - ATTTGACATAATTGACACCTTCAAAACCCTGACCAAGGAACTACTGAGACA

AGAACATTTACCCAAGGTTCTTCAGAAAAAAGAACCCCACCAGCTCACTGATAGAACATTTTTCATTGATGGTTCCAACCAGGGGTTGAAGACCATCCCG

TCAGAGATTTTGGCATTAAAAGAATTAGAAGAAGTGCATCTGGAGAATAACCAGATTGCAGAAATTCCCCAGGGCATTCAGCAGTTACAGAACACCAAGG

TTCTCTACCTGCATAACAACAGCCTGCAAGATCTGTGCCCGGAGCTGGGGGCGCTGAGCAGCCTGGAGTCGCTGGACCTGAGCGGCAACCCGCTGGTCAT

CTCCTCGCTGCACGTCGTCAGCCGCCTCCGCACCCTTCGCGAGCTGCGGCTCTACCGCACTGGCCTGACCGAGATTCCCACCGGCATTTGCAAATCCCTG

CATCACCTGGAGCTGTTCGGTCTGTCAGAGAACTTCCTGGAATCGCTGCCCGAGGAAATCGTGAACCAAACCAAGCTCAGGGAGATCTACCTGAAGCAGA

ATCACTTCGAGGTTTTCCCTTGCGACCTCTGTGTCCTCTACAACCTGGAGGTGATCGACCTGGACGAAAACAAGCTGAAGAGCATCCCCGGAGATATCGG

GCACCTGGTGAGGCTGCAGAAGTTCTACGTGGCGTCTAACCACCTGATGAGTTTACCGGAGTCTCTGAGTCAGTGCAGCAAGCTGTCAGTGCTGGATTTG

ACCCACAACTCTATCCACTCCCTGCCGTCCTCCCTGGAGCTTCTCACCGAGCTCACGGAGGTAGGGCTGAGCGGGAACCGGCTGGAGAAGGTGCCGCGCC

TCCTCTGCAGCTGGGTGTCGCTGCATCTGCTGTACCTGCGCAACACCAGCCTGCACGGGCTGCGGGACTCCTTCAAGCGCCTGATCAACCTGCGCTTCCT

GGACCTCAGTCAGAACCACATAGAACACTTTCCCGTGCAGATTTGCGCGCTCAAGAACCTGGAGATCCTGGCGCTAGATGATAACAAAGTGAGGCAG - 

UNI20725 - TTACCACCGAGCATAAGCTTGCTTTCAAACCTGAAGATACTCGGGCTCACAGGAAATGACCTTTTGTCCTTCCCAGAGGAAATCTTTTC

CTTAATATCTCTGGAGAAATTATATATTGGACAAGACCAGGGGTCCAAGCTTTCATCTTTGCCAGAAAACATCAAGAGATTGATG AATCTTAAGGAACT

ATACATAGAGAACAACCGACTGGAACAGCTGCCAGCATCCTTGGGGTTAATGCCAAATCTGGAAGTTCTTGACTGTCGGCATAATCTTCTTAAGCAACTC

CCAGATGCCATTTGCCGTACTCGAA ATTTGAGAGAGCTGCTGCTGGAAGACAACTTACTCTGCTGCCTCCCAGAGAACCTTGATCACCTGGTAAATCTT

AAGGTCCTAACACTGATGAACAACCCCATGGTCGACCCTCCCATATATGTGTGTAACCAAGGCAATGAAGCCATATGGAAACACCTGAAGGAGAACAGAA

TTAGGAAAATGATGGCCACCACG - UNI14097 - ATTCAGGCATGGTGGCGTGGAATCATGGTCCGGAAAGGATATGGATCTTATGAAGAGCTACTA

AAAGCCCGAAAAAAAGGAAAATCCCCTCCAAAGGACAAGAAAGGGAAAAAGGCTGCAAAGGGGAAGCCTGAAAAAGGGAATAAAAAGTAATTATGTAAAT

GAATTAATGAAAATAAAGATTGCTAACAGAGCAGGAAGGCACCCTGTCTAGGGGCCATAAAACAACCACATGAAAATTAACCATGAAATTAAGGCTGTTT

GTAATAATAAAAGAGTCTTATTTTACTG
Translation
MAYPSAKLQMHR - UNI20641 - RFDIIDTFKTLTKELLRQEHLPKVLQKKEPHQLTDRTFFIDGSNQGLKTIPSEILALKELEEVHLENNQIAEIP

QGIQQLQNTKVLYLHNNSLQDLCPELGALSSLESLDLSGNPLVISSLHVVSRLRTLRELRLYRTGLTEIPTGICKSLHHLELFGLSENFLESLPEEIVNQ

TKLREIYLKQNHFEVFPCDLCVLYNLEVIDLDENKLKSIPGDIGHLVRLQKFYVASNHLMSLPESLSQCSKLSVLDLTHNSIHSLPSSLELLTELTEVGL

SGNRLEKVPRLLCSWVSLHLLYLRNTSLHGLRDSFKRLINLRFLDLSQNHIEHFPVQICALKNLEILALDDNKVRQ - UNI20725 - LPPSISLLSN

LKILGLTGNDLLSFPEEIFSLISLEKLYIGQDQGSKLSSLPENIKRLM NLKELYIENNRLEQLPASLGLMPNLEVLDCRHNLLKQLPDAICRTRN NLR

ELLLEDNLLCCLPENLDHLVNLKVLTLMNNPMVDPPIYVCNQGNEAIWKHLKENRIRKMMATT - UNI14097 - IQAWWRGIMVRKGYGSYEELLKA

RKKGKSPPKDKKGKKAAKGKPEKGNKK
Transcript ENSMUST00000108267
Sequence
AGGAACTCAAGGCAGGGACCTGGAGGCAGGAACTGAAGGAGACGCCATGGAGGAGTTCTGCTTCCTGGCTTGCTGCCCTTAGCTTCCTGTCTCTTTTCTC

ATACCCAGGACCATATGCCCAGAGTTGGCACCAACCCACAGTGATCTGGGCTCTTCCATATTCATCATTAATCAAGAAAATGTCCCCACTGACTTGCCTA

CGGGCAATCTGATGGGAGTATTTTCTCAATGGTGGCCTCTTTGCCCATGTAAATCTAATGTGTCAAGTTAACAAAACAAAACAGATACAAGAGCAACAAC

CAGGACAAAGGACTTGGGGATATTTAGCCAGCTCATGGGAACTAAG TTTTTGGAGTATATTCAGTATGAAAGGATTAGTTTTCCGTATGTTTTCTGAAC

ATAAGTAACAGTACTGGGCCTGGAGCTTCTCCATCGACTCTGGAGCTTTGGAAACATAAATGCATCATTCATCATCAG - UNI32935 - GGTCTCGC

TGTGTTCTTCAGAATGGCCTTGAACTCACAGTCATCCTTCCCCGGCTACACAG - UNI20641 - - UNI30698 - ATTTGACATAATTGACACCT

TCAAAACCCTGACCAAGGAACTACTGAGACAAGAACATTTACCCAAGGTTCTTCAGAAAAAAGAACCCCACCAGCTCACTGATAGAACATTTTTCATTGA

TGGTTCCAACCAGGGGTTGAAGACCATCCCGTCAGAGATTTTGGCATTAAAAGAATTAGAAGAAGTGCATCTGGAGAATAACCAGATTGCAGAAATTCCC

CAGGGCATTCAGCAGTTACAGAACACCAAGGTTCTCTACCTGCATAACAACAGCCTGCAAGATCTGTGCCCGGAGCTGGGGGCGCTGAGCAGCCTGGAGT

CGCTGGACCTGAGCGGCAACCCGCTGGTCATCTCCTCGCTGCACGTCGTCAGCCGCCTCCGCACCCTTCGCGAGCTGCGGCTCTACCGCACTGGCCTGAC

CGAGATTCCCACCGGCATTTGCAAATCCCTGCATCACCTGGAGCTGTTCGGTCTGTCAGAGAACTTCCTGGAATCGCTGCCCGAGGAAATCGTGAACCAA

ACCAAGCTCAGGGAGATCTACCTGAAGCAGAATCACTTCGAGGTTTTCCCTTGCGACCTCTGTGTCCTCTACAACCTGGAGGTGATCGACCTGGACGAAA

ACAAGCTGAAGAGCATCCCCGGAGATATCGGGCACCTGGTGAGGCTGCAGAAGTTCTACGTGGCGTCTAACCACCTGATGAGTTTACCGGAGTCTCTGAG

TCAGTGCAGCAAGCTGTCAGTGCTGGATTTGACCCACAACTCTATCCACTCCCTGCCGTCCTCCCTGGAGCTTCTCACCGAGCTCACGGAGGTAGGGCTG

AGCGGGAACCGGCTGGAGAAGGTGCCGCGCCTCCTCTGCAGCTGGGTGTCGCTGCATCTGCTGTACCTGCGCAACACCAGCCTGCACGGGCTGCGGGACT

CCTTCAAGCGCCTGATCAACCTGCGCTTCCTGGACCTCAGTCAGAACCACATAGAACACTTTCCCGTGCAGATTTGCGCGCTCAAGAACCTGGAGATCCT

GGCGCTAGATGATAACAAAGTGAGGCAG - UNI20725 - TTACCACCGAGCATAAGCTTGCTTTCAAACCTGAAGATACTCGGGCTCACAGGAAATG

ACCTTTTGTCCTTCCCAGAGGAAATCTTTTCCTTAATATCTCTGGAGAAATTATATATTGGACAAGACCAGGGGTCCAAGCTTTCATCTTTGCCAGAAAA

CATCAAGAGATTGATG AATCTTAAGGAACTATACATAGAGAACAACCGACTGGAACAGCTGCCAGCATCCTTGGGGTTAATGCCAAATCTGGAAGTTCT

TGACTGTCGGCATAATCTTCTTAAGCAACTCCCAGATGCCATTTGCCGTACTCGAA ATTTGAGAGAGCTGCTGCTGGAAGACAACTTACTCTGCTGCCT

CCCAGAGAACCTTGATCACCTGGTAAATCTTAAGGTCCTAACACTGATGAACAACCCCATGGTCGACCCTCCCATATATGTGTGTAACCAAGGCAATGAA

GCCATATGGAAACACCTGAAGGAGAACAGAATTAGGAAAATGATGGCCACCACG - UNI14097 - ATTCAGGCATGGTGGCGTGGAATCATGGTCCG

GAAAGGATATGGATCTTATGAAGAGCTACTAAAAGCCCGAAAAAAAGGAAAATCCCCTCCAAAGGACAAGAAAGGGAAAAAGGCTGCAAAGGGGAAGCCT

GAAAAAGGGAATAAAAAGTAATTATGTAAATGAATTAATGAAAATAAAGATTGCTAACAGAGCAGGAAGGCACCCTGTCTAGGGGCCATAAAACAACCAC

ATGAAAATTAACCATGAAATTAAGGCTGTTTGTAATAATAAAAGAGTCTTATTTTACTG
Translation
 MHHSSSG - UNI32935 - GSRCVLQNGLELTVILPRLHR - UNI20641 - - UNI30698 - RFDIIDTFKTLTKELLRQEHLPKVLQKKEP

HQLTDRTFFIDGSNQGLKTIPSEILALKELEEVHLENNQIAEIPQGIQQLQNTKVLYLHNNSLQDLCPELGALSSLESLDLSGNPLVISSLHVVSRLRTL

RELRLYRTGLTEIPTGICKSLHHLELFGLSENFLESLPEEIVNQTKLREIYLKQNHFEVFPCDLCVLYNLEVIDLDENKLKSIPGDIGHLVRLQKFYVAS

NHLMSLPESLSQCSKLSVLDLTHNSIHSLPSSLELLTELTEVGLSGNRLEKVPRLLCSWVSLHLLYLRNTSLHGLRDSFKRLINLRFLDLSQNHIEHFPV

QICALKNLEILALDDNKVRQ - UNI20725 - LPPSISLLSNLKILGLTGNDLLSFPEEIFSLISLEKLYIGQDQGSKLSSLPENIKRLM NLKELYI

ENNRLEQLPASLGLMPNLEVLDCRHNLLKQLPDAICRTRN NLRELLLEDNLLCCLPENLDHLVNLKVLTLMNNPMVDPPIYVCNQGNEAIWKHLKENRI

RKMMATT - UNI14097 - IQAWWRGIMVRKGYGSYEELLKARKKGKSPPKDKKGKKAAKGKPEKGNKK

For any suggestions or comments, please send an email to unitrap@crg.es