Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027708 (Dcun1d1)
Chromosomal location
Chr 3: 35791906 - 35831734 (-)
Description
DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) Gene [Source:MGI (curated);Acc:Dcun1d1-001]
RefSeq_peptide
NP_296372.3 
UniGene
Mm.374810 Mm.379305 
MGI
MGI:2150386 
Uniprot/SWISSPROT
Q9QZ73 
Uniprot/SPTREMBL
Q3UT23 Q3TMV8 
Human Ortholog
not available
Omim not available
UniTrap UNI7522
Vector Insertion
Chr 3: 35828997 - 35831706
Public Clones RRR261 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19014
Vector Insertion
Chr 3: 35820110 - 35828867
Public Clones not available
Private Clones OST406997 (lexicon) OST394004 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121632
Sequence
GTGTGGCATGAGTTGAAGAGGTCACTAGAGTAAAGACGGGAAGTAATAGGTTGTGCTTTGCCTGGTGAACATTGGAAAGATACCAGAGTTTTTCAGAGAC

AGGAAGCACTGCGTGGTAAACTCTGAGCG - UNI19014 - AACAAGTTGAAATCATCGCAGAAGGATAAAGTTCGTCAGTTTATGATCTTCACACAA

TCTAGTGAGAAAACTGCAGTAAGTTGTCTTTCTCAAAATGACTGGAAGTTAGATGTTGCAACAGATAATTTTTTTCAAAATCCAGAACTTTATATACGGG

AGAGTGTAAAAGGATCGTTGGACAGGAAGAAGTTAGAGCAACTGTACACTAGATACAAAG ACCCTCAGGATGAAAATAAAATTGGAATAGATGGTATAC

AGCAGTTCTGTGATGATCTGGCCCTCGATCCAGCCAGCATCAGTGTGTTGATCATTGCATGGAAGTTCAGGGCGGCCACACAGTGCGAGTTCTCCAAACA

GGAGTTCATGGATGGCATGACAGAGTTAGG ATGTGACAGCATAGAAAAACTAAAGGCCCAAATACCCAAGATGGAACAAGAATTGAAAGAACCAGGACG

ATTTAAGGATTTTTACCAGTTTACTTTTAATTTTGCAAAGAATCCAGGACAAAAAGGATTAG ATCTAGAAATGGCCATTGCTTACTGGAACTTAGTGCT

TAATGGAAGATTTAAATTCTTAGACTTATGGAATAAATTTTTGTTG GAGCATCATAAACGATCAATACCAAAAGACACGTGGAATCTTCTGTTAGACTT

CAGTTCAATGATTGCAGATGACATGTCCAATTATGATGAAGAAG GAGCATGGCCTGTCCTTATTGATGACTTTGTGGAATTTGCACGCCCTCAAATTGC

TGGGACAAAAAGTACAACAGTGTAGCACTAAAGGAACCTTCTAGAATGTACATAGTCTGTACAATAAATACAACGGAAAATGCACAGTCAATTTCTGCTG

GCTGGACTGAAGATCAATCCTCATAATTCAAACTGAGGGTTGAGACAAAACTTTTAAGGATACATCTTGGACCATATCGTACTCCATTCTTCTACTGGTG

GTTTGGGCTTGTCTTCTAGTCTGGGCCACTCTAAGCATTTATAATTCCGACATTGTGGATTTCATCTTACACCTGTGGACCATCTTAGTCTGTCTTCCCA

TAAGTCATAGAAGCTTGATGGTGATTATTTTGAGGTTTCCATTCTTGCATAAAGCACAATGCTGTCTTCATCAGAAAACAGTTTGGCATAAGAATTAAAC

ATAATAATGAACACCACAACAATTTATAAAAACTTCTTAAGTATATGCTTTGGGCTAGTTGCAAAGACTGTGCTGGCAGCACTTCAAATGAGAGTGATTT

ATCTGAGTGTACCGCATCTGAAATGGTGTTTGGTTGGGGGAATTTAATTTTCCTGGCAAACTACATGTACTGCTGGTGTGAGTAGAATACCTGATATAAG

AAATATCAAAATAACCAACACATGAAAAAAAAAAAGGATAATCTGGGGACTCCCTGAAATATGTCTTGTGTTTCAGACGCTCAGAAAGGTTCTACAGAAC

AGGTCTGTGGTTATCTTACCCATGTTTATACAGTGTCCTGCAGTGAACTTTTATTTAAAAAAATATTGTAATGAGATCAGATGTTAGACTCCACACTCGT

GCATCACACACCACATAATCGGATTTCATTGTGCTCTGAAATACTTCTATGCCTTCTGAATAAGTTAAACTATTTCATTTGTTTTGAATGTTTTGGATTG

CTATACAATATAATATTCTAAATTTAGGCATGAGGGTATTAGGTTTGTTTGTTTTTTTTTTTAATTTTTTGTCATCGCACTATGGAACACAATGCAATTC

ACTTAATTTATAAGAAGATAGTAAGATTTAGATTTTGAAAATGGTTGTGATGAGCCGTGAAGTTCAACCTTTCTCCCATGGCACTGCTCTTTGAGGCGTG

GTCCAGCCATGTTGGCTGCTGACTGTTGAGATGGCTTACTGCTAAATCACTGTGGTTGCCAAGTCTACTCCAGAAGCAGAGATTGTCAGACAGGCGAGCA

CTGGTGCAGATACCAATGGCTTCTGTTCTATAAATTATTTGACTTTTGACTGTTTTTGTCTCACTTGCATTTGCTATTTCCACATCACAGCAGAATGCAG

TCTTGATTGGTTTTGTTTTTTGTTTTTCCATGACAGGACTCATGCCTTGCTCTCCTGCTGAAAATGCTTGTTTCTCTGATAACATACTGACATGTGAAAG

GGGTGTATTCATACATATTTCCATGAGGAAGTTAAAATGATGAACTAAATGTTGGGTGACTGGTCTTCAATAGGAACAGATTTTGCTTCATGTATCCAGG

TCCTCTGCAGGGTACCAAGGAATGTTCTTCAGGATAGCGGAACAATTTATGCAGATATGGAAATGATTAAAACTGCTTTTTAGTCACATGATTTGGAAAA

TGCATTGAAAGCTTACCTTACAGATATATCATTAATCCAATCATAACTTTAATTTAGGAATGCATTTCTACCAAAAGAAGCTTAGAGTAAATTTCTATTC

ACGTTACAGGGATTGGTCATTAAAAGGAAAAGAATCTTGCTGTTTTCAGTATTTCTTGATTTCATTTTTTGTAAATATAAAGAACTTCAATTATGAAAAA

AATTAAAGATATATGTATATATATCTTTAAAAGTTTTACAGACCTATATTGTTTATTCCCTACATGGAACATTTTGAGTTTTGGTATTGTTTTCAGATTG

ATTGATTCAGATATGATTTGTTTTCAAATGAGACTCCATTAGCTTCTTTCCCTGCCTCATAAATTTTTTTTCATAAAAATCTTGATATTTGTGTGTGGCC

TAATGCTTTGGGTTTTACAGATTTTATTTTTAAATGCAAGACTTTTTAACAAAATAGTGTTTGTCATCAGTTTGGTACTAAACATTTACAATTACTGTGT

AATTATAAACAAAAATATATAAAGCTTTTATTATGTAGC
Translation
 - UNI19014 - MIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYTRYKD DPQDENKIGIDGIQQFCDDLALDPAS

ISVLIIAWKFRAATQCEFSKQEFMDGMTELG GCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLD DLEMAIAYWNLVLNGRFKFLDL

WNKFLL EHHKRSIPKDTWNLLLDFSSMIADDMSNYDEEG GAWPVLIDDFVEFARPQIAGTKSTTV
Transcript ENSMUST00000029258
Sequence
GGGGAGAGGTCCGGAGGACACCAACATG - UNI7522 - - UNI19014 - AACAAGTTGAAATCATCGCAGAAGGATAAAGTTCGTCAGTTTATGA

TCTTCACACAATCTAGTGAGAAAACTGCAGTAAGTTGTCTTTCTCAAAATGACTGGAAGTTAGATGTTGCAACAGATAATTTTTTTCAAAATCCAGAACT

TTATATACGGGAGAGTGTAAAAGGATCGTTGGACAGGAAGAAGTTAGAGCAACTGTACACTAGATACAAAG ACCCTCAGGATGAAAATAAAATTGGAAT

AGATGGTATACAGCAGTTCTGTGATGATCTGGCCCTCGATCCAGCCAGCATCAGTGTGTTGATCATTGCATGGAAGTTCAGGGCGGCCACACAGTGCGAG

TTCTCCAAACAGGAGTTCATGGATGGCATGACAGAGTTAGG ATGTGACAGCATAGAAAAACTAAAGGCCCAAATACCCAAGATGGAACAAGAATTGAAA

GAACCAGGACGATTTAAGGATTTTTACCAGTTTACTTTTAATTTTGCAAAGAATCCAGGACAAAAAGGATTAG ATCTAGAAATGGCCATTGCTTACTGG

AACTTAGTGCTTAATGGAAGATTTAAATTCTTAGACTTATGGAATAAATTTTTGTTG GAGCATCATAAACGATCAATACCAAAAGACACGTGGAATCTT

CTGTTAGACTTCAGTTCAATGATTGCAGATGACATGTCCAATTATGATGAAGAAG GAGCATGGCCTGTCCTTATTGATGACTTTGTGGAATTTGCACGC

CCTCAAATTGCTGGGACAAAAAGTACAACAGTGTAGCACTAAAGGAACCTTCTAGAATGTACATAGTCTGTACAATAAATACAACGGAAAATGCACAGTC

AATTTCTGCTGGCTGGACTGAAGATCAATCCTCATAATTCAAACTGAGGGTTGAGACAAAACTTTTAAGGATACATCTTGGACCATATCGTACTCCATTC

TTCTACTGGTGGTTTGGGCTTGTCTTCTAGTCTGGGCCACTCTAAGCATTTATAATTCCGACATTGTGGATTTCATCTTACACCTGTGGACCATCTTAGT

CTGTCTTCCCATAAGTCATAGAAGCTTGATGGTGATTATTTTGAGGTTTCCATTCTTGCATAAAGCACAATGCTGTCTTCATCAGAAAACAGTTTGGCAT

AAGAATTAAACATAATAATGAACACCACAACAATTTATAAAAACTTCTTAAGTATATGCTTTGGGCTAGTTGCAAAGACTGTGCTGGCAGCACTTCAAAT

GAGAGTGATTTATCTGAGTGTACCGCATCTGAAATGGTGTTTGGTTGGGGGAATTTAATTTTCCTGGCAAACTACATGTACTGCTGGTGTGAGTAGAATA

CCTGATATAAGAAATATCAAAATAACCAACACATGAAAAAAAAAAAGGATAATCTGGGGACTCCCTGAAATATGTCTTGTGTTTCAGACGCTCAGAAAGG

TTCTACAGAACAGGTCTGTGGTTATCTTACCCATGTTTATACAGTGTCCTGCAGTGAACTTTTATTTAAAAAAATATTGTAATGAGATCAGATGTTAGAC

TCCACACTCGTGCATCACACACCACATAATCGGATTTCATTGTGCTCTGAAATACTTCTATGCCTTCTGAATAAGTTAAACTATTTCATTTGTTTTGAAT

GTTTTGGATTGCTATACAATATAATATTCTAAATTTAGGCATGAGGGTATTAGGTTTGTTTGTTTTTTTTTTTAATTTTTTGTCATCGCACTATGGAACA

CAATGCAATTCACTTAATTTATAAGAAGATAGTAAGATTTAGATTTTGAAAATGGTTGTGATGAGCCGTGAAGTTCAACCTTTCTCCCATGGCACTGCTC

TTTGAGGCGTGGTCCAGCCATGTTGGCTGCTGACTGTTGAGATGGCTTACTGCTAAATCACTGTGGTTGCCAAGTCTACTCCAGAAGCAGAGATTGTCAG

ACAGGCGAGCACTGGTGCAGATACCAATGGCTTCTGTTCTATAAATTATTTGACTTTTGACTGTTTTTGTCTCACTTGCATTTGCTATTTCCACATCACA

GCAGAATGCAGTCTTGATTGGTTTTGTTTTTTGTTTTTCCATGACAGGACTCATGCCTTGCTCTCCTGCTGAAAATGCTTGTTTCTCTGATAACATACTG

ACATGTGAAAGGGGTGTATTCATACATATTTCCATGAGGAAGTTAAAATGATGAACTAAATGTTGGGTGACTGGTCTTCAATAGGAACAGATTTTGCTTC

ATGTATCCAGGTCCTCTGCAGGGTACCAAGGAATGTTCTTCAGGATAGCGGAACAATTTATGCAGATATGGAAATGATTAAAACTGCTTTTTAGTCACAT

GATTTGGAAAATGCATTGAAAGCTTACCTTACAGATATATCATTAATCCAATCATAACTTTAATTTAGGAATGCATTTCTACCAAAAGAAGCTTAGAGTA

AATTTCTATTCACGTTACAGGGATTGGTCATTAAAAGGAAAAGAATCTTGCTGTTTTCAGTATTTCTTGATTTCATTTTTTGTAAATATAAAGAACTTCA

ATTATGAAAAAAATTAAAGATATATGTATATATATCTTTAAAAGTTTTACAGACCTATATTGTTTATTCCCTACATGGAACATTTTGAGTTTTGGTATTG

TTTTCAGATTGATTGATTCAGATATGATTTGTTTTCAAATGAGACTCCATTAGCTTCTTTCCCTGCCTCATAAATTTTTTTTCATAAAAATCTTGATATT

TGTGTGTGGCCTAATGCTTTGGGTTTTACAGATTTTATTTTTAAATGCAAGACTTTTTAACAAAATAGTGTTTGTCATCAGTTTGGTACTAAACATTTAC

AATTACTGTGTAATTATAAACAAAAATATATAAAGCTTTTATTATGTAGCAAAAAGAGTTAAGGTTGTTCACCATGATGGCATCTTAGAATTAAACAAGA

CTTGCTAGGGCTCCAAGAGAAAATTGATTTAATGTGTTTATTCTGAGGGTGACTGTCTGGTTCTAGGAAATGTTTTGTAATACAAATGCTTACCCTATTG

GGGGCGGGGCGTCGGGGAGTCTTCCAGAGGAAGGGCACACTCACTCACACACAGCCAGCTATTGCCGGCAGAGGATCATGGGGTTCAGTCTTCGTGTGGG

TCAGGTCTCCAAGCTGATTCTTTTCTTTCCAGACAGAACCATAGGGAGAGTTTACTTTTTGCCAAATGTCAGAACAGGTACACATTTTTAAATGTAATGC

TTTTTAAATAGTAAACTGTATAAAATGAGAAGTACCCACATATAAAAATACTTGAGGTCAAGGTTCTCTTGAGTGACTATCATCTGCATATCTCTGTAAG

TTCAAGTGTGTCGTTTCCAATCCCTGTCATATTACCCACAGAGGCAATAAAAGCTTCAGTAAATTTGCCATG
Translation
 - UNI7522 - - UNI19014 - MIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYTRYKD DPQDENKIGIDGIQ

QFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELG GCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLD DLEMAIAYWN

LVLNGRFKFLDLWNKFLL EHHKRSIPKDTWNLLLDFSSMIADDMSNYDEEG GAWPVLIDDFVEFARPQIAGTKSTTV
Transcript ENSMUST00000108182
Sequence
GGGGAGAGGTCCGGAGGACACCAACATG - UNI7522 - - UNI19014 - AACAAGTTGAAATCATCGCAGAAGGATAAAGTTCGTCAGTTTATGA

TCTTCACACAATCTAGTGAGAAAACTGCAGTAAGTTGTCTTTCTCAAAATGACTGGAAGTTAGATGTTGCAACAGATAATTTTTTTCAAAATCCAGAACT

TTATATACGGGAGAGTGTAAAAGGATCGTTGGACAGGAAGAAGTTAGAGCAACTGTACACTAGATACAAAG ACCCTCAGGATGAAAATAAAATTGGAAT

AGATGGTATACAGCAGTTCTGTGATGATCTGGCCCTCGATCCAGCCAGCATCAGTGTGTTGATCATTGCATGGAAGTTCAGGGCGGCCACACAGTGCGAG

TTCTCCAAACAGGAGTTCATGGATGGCATGACAGAGTTAGG ATGTGACAGCATAGAAAAACTAAAGGCCCAAATACCCAAGATGGAACAAGAATTGAAA

GAACCAGGACGATTTAAGGATTTTTACCAGTTTACTTTTAATTTTGCAAAGAATCCAGGACAAAAAGGATTAG ATCTAGAAATGGCCATTGCTTACTGG

AACTTAGTGCTTAATGGAAGATTTAAATTCTTAGACTTATGGAATAAATTTTTGTTG GAGCATCATAAACGATCAATACCAAAAGACACGTGGAATCTT

CTGTTAGACTTCAGTTCAATGATTGCAGATGACATGTCCAATTATGATGAAGAAG GAGCATGGCCTGTCCTTATTGATGACTTTGTGGAATTTGCACGC

CCTCAAATTGCTGGGACAAAAAGTACAACAGTGTAGCACTAAAGGAACCTTCTAGAATGTACATAGTCTGTACAATAAATACAACGGAAAATGCACAGTC

AATTTCTGCTGGCTGGACTGAAGATCAATCCTCATAATTCAAACTGAGGGTTGAGACAAAACTTTTAAGGATACATCTTGGACCATATCGTACTCCATTC

TTCTACTGGTGGTTTGGGCTTGTCTTCTAGTCTGGGCCACTCTAAGCATTTATAATTCCGACATTGTGGATTTCATCTTACACCTGTGGACCATCTTAGT

CTGTCTTCCCATAAGTCATAGAAGCTTGATGGTGATTATTTTGAGGTTTCCATTCTTGCATAAAGCACAATGCTGTCTTCATCAGAAAACAGTTTGGCAT

AAGAATTAAACATAATAATGAACACCACAACAATTTATAAAAACTTCTTAAGTATATGCTTTGGGCTAGTTGCAAAGACTGTGCTGGCAGCACTTCAAAT

GAGAGTGATTTATCTGAGTGTACCGCATCTGAAATGGTGTTTGGTTGGGGGAATTTAATTTTCCTGGCAAACTACATGTACTGCTGGTGTGAGTAGAATA

CCTGATATAAGAAATATCAAAATAACCAACACATGAAAAAAAAAAAGGATAATCTGGGGACTCCCTGAAATATGTCTTGTGTTTCAGACGCTCAGAAAGG

TTCTACAGAACAGGTCTGTGGTTATCTTACCCATGTTTATACAGTGTCCTGCAGTGAACTTTTATTTAAAAAAATATTGTAATGAGATCAGATGTTAGAC

TCCACACTCGTGCATCACACACCACATAATCGGATTTCATTGTGCTCTGAAATACTTCTATGCCTTCTGAATAAGTTAAACTATTTCATTTGTTTTGAAT

GTTTTGGATTGCTATACAATATAATATTCTAAATTTAGGCATGAGGGTATTAGGTTTGTTTGTTTTTTTTTTTAATTTTTTGTCATCGCACTATGGAACA

CAATGCAATTCACTTAATTTATAAGAAGATAGTAAGATTTAGATTTTGAAAATGGTTGTGATGAGCCGTGAAGTTCAACCTTTCTCCCATGGCACTGCTC

TTTGAGGCGTGGTCCAGCCATGTTGGCTGCTGACTGTTGAGATGGCTTACTGCTAAATCACTGTGGTTGCCAAGTCTACTCCAGAAGCAGAGATTGTCAG

ACAGGCGAGCACTGGTGCAGATACCAATGGCTTCTGTTCTATAAATTATTTGACTTTTGACTGTTTTTGTCTCACTTGCATTTGCTATTTCCACATCACA

GCAGAATGCAGTCTTGATTGGTTTTGTTTTTTGTTTTTCCATGACAGGACTCATGCCTTGCTCTCCTGCTGAAAATGCTTGTTTCTCTGATAACATACTG

ACATGTGAAAGGGGTGTATTCATACATATTTCCATGAGGAAGTTAAAATGATGAACTAAATGTTGGGTGACTGGTCTTCAATAGGAACAGATTTTGCTTC

ATGTATCCAGGTCCTCTGCAGGGTACCAAGGAATGTTCTTCAGGATAGCGGAACAATTTATGCAGATATGGAAATGATTAAAACTGCTTTTTAGTCACAT

GATTTGGAAAATGCATTGAAAGCTTACCTTACAGATATATCATTAATCCAATCATAACTTTAATTTAGGAATGCATTTCTACCAAAAGAAGCTTAGAGTA

AATTTCTATTCACGTTACAGGGATTGGTCATTAAAAGGAAAAGAATCTTGCTGTTTTCAGTATTTCTTGATTTCATTTTTTGTAAATATAAAGAACTTCA

ATTATGAAAAAAATTAAAGATATATGTATATATATCTTTAAAAGTTTTACAGACCTATATTGTTTATTCCCTACATGGAACATTTTGAGTTTTGGTATTG

TTTTCAGATTGATTGATTCAGATATGATTTGTTTTCAAATGAGACTCCATTAGCTTCTTTCCCTGCCTCATAAATTTTTTTTCATAAAAATCTTGATATT

TGTGTGTGGCCTAATGCTTTGGGTTTTACAGATTTTATTTTTAAATGCAAGACTTTTTAACAAAATAGTGTTTGTCATCAGTTTGGTACTAAACATTTAC

AATTACTGTGTAATTATAAACAAAAATATATAAAGCTTTTATTATGTAGCAAAAAGAGTTAAGGTTGTTCACCATGATGGCATCTTAGAATTAAACAAGA

CTTGCTAGGGCTCCAAGAGAAAATTGATTTAATGTGTTTATTCTGAGGGTGACTGTCTGGTTCTAGGAAATGTTTTGTAATACAAATGCTTACCCTATTG

GGGGCGGGGCGTCGGGGAGTCTTCCAGAGGAAGGGCACACTCACTCACACACAGCCAGCTATTGCCGGCAGAGGATCATGGGGTTCAGTCTTCGTGTGGG

TCAGGTCTCCAAGCTGATTCTTTTCTTTCCAGACAGAACCATAGGGAGAGTTTACTTTTTGCCAAATGTCAGAACAGGTACACATTTTTAAATGTAATGC

TTTTTAAATAGTAAACTGTATAAAATGAGAAGTACCCACATATAAAAATACTTGAGGTCAAGGTTCTCTTGAGTGACTATCATCTGCATATCTCTGTAAG

TTCAAGTGTGTCGTTTCCAATCCCTGTCATATTACCCACAGAGGCAATAAAAGCTTCAGTAAATTTGCCATG
Translation
M - UNI7522 - - UNI19014 - NKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYTRYKD

 DPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELG GCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQ

KGLD DLEMAIAYWNLVLNGRFKFLDLWNKFLL EHHKRSIPKDTWNLLLDFSSMIADDMSNYDEEG GAWPVLIDDFVEFARPQIAGTKSTTV

For any suggestions or comments, please send an email to unitrap@crg.es