Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027751 (D3Ertd300e)
Chromosomal location
Chr 3: 54497035 - 54532684 (+)
Description
Protein FAM48A (p38-interacting protein)(p38IP) [Source:UniProtKB/Swiss-Prot;Acc:Q7TT00]
RefSeq_dna
NM_019995 
RefSeq_peptide
NP_064379.1 
UniGene
Mm.37356 
MGI
MGI:1929651 
Uniprot/SWISSPROT
Q7TT00 
Human Ortholog
ENSG00000102710 (FAM48A)
Omim not available
UniTrap UNI26881
Vector Insertion
Chr 3: 54497131 - 54499044
Public Clones (sanger)
Private Clones OST88662 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24189
Vector Insertion
Chr 3: 54499130 - 54500405
Public Clones not available
Private Clones OST231793 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38096
Vector Insertion
Chr 3: 54502582 - 54505408
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3386
Vector Insertion
Chr 3: 54507097 - 54510781
Public Clones XP0391 (sanger) RRK304 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029315
Sequence
AAAATCGCTGCAAGGTTGGCAGAATGCTTCTTCAGGGCGGAGTGCGGTGTGACTGTTGAGTAGAGGTTGCTTCTCTGTGGAGTTGGCGTTCTGAGG - U

NI26881 - TATAGAAGAAGACATGGTTTCCACCCCACTTCCACAGCACGTCTAAGTTTTATCTTTTTTGGGGTCCTTATCTGTTGCCACAATG - UN

I24189 - CAACAAGCTGTAGAACAAGCTTTGGATTGCGCAGAG TACATCGTGGAAAGTGCTCAGCAGAGACCTCCTAAAAGGAAATACCTGTCTAGT

GGAAG AAAGTCTATATTTCAAAAACTTTATGACTTATATGTTGAAGAATGTGAAAAAGAACCCGAGGTTAAG CAGAAATTAAGAAGAAATGTGAACTT

GTTAGAGAAGCTTGTTATGCAGGAGACTTTGTCGTGTTTAGTAGTCAATCTGTACCCAGGAAATGAAGGCTATTCTCTGATGCTCAGGGGGAAAAATGGA

TCAG ATTCTGAGACCATCCGATTGCCTTATGAAGAAGGAGAATTGCTTGAATACTTAGATGCAGAAGAATTACCTCCTATTTTGGTGGATCTCCTTGAA

AAATCACAG - UNI3386 - GTTAATATTTTTCATTGTGGATGTGTGATAGCAGAAATACGTGACTATAGGCAGTCCAGTAATATGAAGTCTCCTGGT

TACCAAAGTAGGCACATTCTCTTACGTCCAACAATGCAG ACTTTAGTCTGTGATGTCCATTCTATAACAAGTGACAACCATAAGTGGACCCAG GAAGA

CAAACTTTTGCTTGAGAGCCAGCTGATTCTAGCTACAGCAGAGCCACTGTGTCTTGACCCATCGGTGGCAGTAGCGTGCACTGCCAATAGGCTGCTCTAT

AACCGGCAGAAGATGAACACTCGCCCAATGAAACG GTGTTGGAAGAGGTACTCCAGGTCCTCCCTGAACCGCCAGCAGGACCTCTCTCACGGCCCTCCT

CCCCCTCAGCTGAGACTACTTGATTTCTTACAAAAGCGGAAGGAAAGGAAAGCAGGCCAGCATTATGACCTCAAAATTTCCAAAGCAGGAAAT TGTGTA

GACATGTGGAAACGGAGCCCCTGTAACTTGGCTGTGCCTTCTGAAGTAGAT GTGGAAAAATATGCTAAAGTGGAGGAATCCATCAAATCTGACGACTCA

CAGCCAACAATGTGGCCAGCTCAT GATGTAAAAGACGATTATGTATTTGAATGTGAAGGTGGTAATCAGTATCAGAAAACAAAGCTGACCATCTTGCAG

TCTCTTGGGGATCCACTTTACTATGGTAAAATACAGCCGTGGAAAGCAGATGAAGAAAATGACAGCCAAATGTCTCCATCCCA CTCCTCTGCTGATGAC

CATTCAAACTG GTTTGTCATTGGGTCAAAGACTGACGCAGAGAG GGTAGTTAATCAATACCAGGAGTTGGTCCAGAATGAAGCCAAATGCCCAGTGAA

GATGTCACACAGCAGTAGTGGTTCAGCCGCTCTCAGTCCAGGGGAGGAGGCAGAA CAGGCGGAGACCTCGTCCATTCAGTCTTCAGTTTTGGGAAAGGG

AGTAAAACACCGACCCCCACCCATCAAACTTCCCTCAGGCTCAGGAAATAGTTCCTCAG GTAACTATTTCACAGCACAGCAGGCCAGCAGCTTCCTTAA

ATCTCCAACTCCTCCTCCATCGTGTAAGCCAAGCCTTTCTCGGAAGTCTTCTGTGGACCTCAGTCAAGTTAGCATGCTTTCTCCTGCCGCCCTGTCCCCT

GCCAGCTCATCCCAGA GACATGAAAGCTAAAAAGGAAACACCTCAAGAGCTTTGCTTTACTTTTTTGGTTTCATTTTTAAAAATTTTTTTAAGTTGATA

AAACTGTGCATACTTCATTCACGACAGATTTTCTATACATTCAACATTTAAACAGAAGTACACAGTTACTGTTAAAGATGCAGTATTATCTATAAAGTAC

CTGCTTTATTCTTTGTAAATTTCTTTGTCAGGGTAAACTTGATATGTTGGGAATTAAACATGTATATCTGAGTGCCATAACTGATAGCTTGTGTACTTAC

TAAGTATGTTGACAGTTTATCTTCGACAGTTAAACTAAAATAAGCAGTATTTTTTTAAGAAGTCTTAAATTAGTGAACTCACAAGTAACAAAAAATTAAC

TTAAAGTCATTCTCAGCTTTGTAGGCAAAAGACAGCATGTAGGAGACTAACTTTTTATTGGGTGTTGTGGTAGAGTGTAAGTGTATTTCCACTGTTAACT

GTGATCTGAGTGGGGTTTCTAGGTGATATACTGCATCCTTAATTGTAATTGAGTGTAGCAACACTCTTGGATCGTGTAGAGAGTTAACACTTGCAGTTAA

CTGCTTTTAAACAAATTGGAACAAATTTGTCAGTGCTAAGTAAGATTCCATTAACCGTATTTTAAAAGGACCAGCCATTTATAACAAACTAGCAATTTTT

ATTTTTCTCAACGAGCAGGATCTGGAACTCCTAAGCCATCTCCTCCTACACCAACCCCTTCATCGGTCCCACACCCTCCTGACGCTCAGAACTCAGCTCC

TAGTACCCCTTCAGCCACCCCATCTCCCCAAGAATCAGGCTTCACCCCTCAGCCCACTTTGTTAACTCAGTTTGCTCAGCAGCAAAGGGCTCTGAGCCAG

GCAATGCCTGTGACAACCATTCCTCTTTCTACCATGGTAACGTCCATAACAACAGGAAGCTCGCTCTCCCCGGTCATGGCAGACTCTGCTGGGCTAACCT

CCGTCAGTGTACTGAGCTCTGCTGG TGGAGCCCAGGCTCTGAAGAGTGGCTCAAACTCCATGCTGGGCTGTGACACTGGGGCCATACCTCCTGCAGGAA

AAAGCCTGTGCAGCGGCCTTCTGCCATCAGGAGGTCTCGTAGCAAACACACTGCCCAGTGCCGTGCAGGCGGCTCCTCAAGCAG GTATCCCATTTGGTT

TACAAAATACTTCAAGTCTCAGACCTTTAAATCTACTCCAG CTTCCTGGTGGTTCACTCATTTTTAACACCCAGCAGCAACAGCAGCAGACGCAGCTCC

CTCACTTTATACAACAACCTCAGCAGCCTGCAGCTTCCGGTTCCCAACAGCCAGAGGAGCAG GGTTCTGAACAAGGGTTAACTGCGCAGGAACAGGCCT

TAACTGCTCAGCAAGCTGCCGTTATTAACCTTACTGGAGTAGGAGGCTTTCCCCAGTCACAGGCAGCCG TGTTGTCTCAGCTTGGCTCTGCTGAGAACA

GACCTGAGCAAAGCCTTCCTCAGCAGAGACTCCAGCTCTCCTCTGCCTTTCAGCAGCAGCAGCAGCAGCAGCAACAACAACAACAACAGCAACTACAA C

AGTTGCGATTCTTGCAGCACCAAATGGCTATGGCAGCAGCAGCCGCACAAACAGCCCAGCTACATCGTCACCGGCACACAGGCAGCCAGTCAAAGAGTAA

AATGAAGAGAGGCATGCCAACTACTCCAAAATTCTGAGCAATTTTTTTTTTCTTTTTTACAAACACGACCATTGAATGAATTGTATTTCTACTGTTTTCC

CGAGATGTCAGTATTTTGCATTGCTGTGTGTGCACACTTTACACAGAAGCACAGCCCTGTGATTCTTACATGGAAACATGGTGAAATGTTTTCCTGTACA

TACCAATCGCAGAAACAACGTAAGGACTAGAAATATCTTTCAAAGAATGGAATTAGGTATTTATTTAGTATAAAAAGCCTGTGCAGTGTAACAAATACAA

TTTTTACAGCTGTTTTGC
Translation
 - UNI26881 - M - UNI24189 - QQAVEQALDCAE YIVESAQQRPPKRKYLSSGR RKSIFQKLYDLYVEECEKEPEVK QKLRRNVNLLEKL

VMQETLSCLVVNLYPGNEGYSLMLRGKNGSD DSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQ - UNI3386 - VNIFHCGCVIAEIRDYRQSS

NMKSPGYQSRHILLRPTMQ TLVCDVHSITSDNHKWTQ EDKLLLESQLILATAEPLCLDPSVAVACTANRLLYNRQKMNTRPMKR RCWKRYSRSSLNR

QQDLSHGPPPPQLRLLDFLQKRKERKAGQHYDLKISKAGN CVDMWKRSPCNLAVPSEVD VEKYAKVEESIKSDDSQPTMWPAH DVKDDYVFECEGGN

QYQKTKLTILQSLGDPLYYGKIQPWKADEENDSQMSPSH HSSADDHSNW WFVIGSKTDAER RVVNQYQELVQNEAKCPVKMSHSSSGSAALSPGEEA

E QAETSSIQSSVLGKGVKHRPPPIKLPSGSGNSSSG GNYFTAQQASSFLKSPTPPPSCKPSLSRKSSVDLSQVSMLSPAALSPASSSQR RHES    

  

For any suggestions or comments, please send an email to unitrap@crg.es