Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027763 (Mbnl1)
Chromosomal location
Chr 3: 60305174 - 60433670 (+)
Description
muscleblind-like 1 (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:1928482]
RefSeq_dna
NM_020007 
RefSeq_peptide
NP_064391.2 
UniGene
Mm.255723 
MGI
MGI:1928482 
Uniprot/SWISSPROT
Q9JKP5 
Uniprot/SPTREMBL
Q4VA08 Q8CAQ1 Q3U581 Q8CHF5 
Human Ortholog
ENSG00000152601 (MBNL1)
Omim not available
UniTrap UNI31967
Vector Insertion
Chr 3: 60305346 - 60332677
Public Clones IST12291G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4392
Vector Insertion
Chr 3: 60333727 - 60399515
Public Clones AE0478 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI715
Vector Insertion
Chr 3: 60419696 - 60425344
Public Clones DB0118 (sanger) DB0126 (sanger) F048E04 (ggtc) IST14901B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000076983
Sequence
GGCGACATGCCACAGTCTCTCGCCGCAGCCCGTCGAGTCGGGGCGCTCGCCATGCTCCCGTGACCCGGACCCGGCCAGTTCCCTTTCCCGTGGCGGGCAT

CCCGGAGTCGCGATCCCACAATGCCCCGGGCAGTCGGGGCCCCGGCGGGCAGCCTGCACGGCCACGTGAGAG - UNI31967 - GTTGGTACTAAGAA

GTGCCTTTCCTGACGTCTCTGCTGCTTGGAACCGCTTCTAGAGCAGCCTCTGCTTTTGCCTTGCTTGCTGCCAGCTAGACTGACGACAGCACATCCGCCC

TCCACCTCTAGCCCAGACACCCCATTTCTACTTCTAATCAGGAGAAAAGCTCTGAGTATCTGCCATTGCCCTAGGCTGCTTTAGTTTAGAAGAAAAGTTT

GCTGAAAAAGTAAGATACCTTCTGCCAGGAAATCAAGGAGGAAAAAAAAAAATCATTTTCTCGATTTTGCTCTAAACTGCTGCATCTGTCTATGCCAAAC

TAATCAATACCGATTGCACCACCAAACTCCATCGCAAATCAGCTGTGAGGAGATTCCCTGTCAGACAACTTTGCTGAAAGCAGCTTGGAAATTCGGTGTC

AAAGGGTCTGCCACGTTTTCATGCTTGCATTTTGGGCTCCAAATTGGCACTGGGAAGGGGTTACTGAGCACACGGCTGAGTCCAGGCCTCCTCTAAACAC

CCATCTACTTACAGTCCTGGTATTCCTCTCAAAACCAAAACCTCTTTGAATTAACAGTTTCATGCTGTGAATTTCTAGCGGAGGTCTTTCCCTTTATATT

GAAGTCACACTTTTCCATGTGCCGTTAAATCGGGGACGGGGGAAGCAGCCTTTCGGACATTTTCACAGTTATCTCACACTCTGAGTTTTATCAGTTCCTA

TTTTGTTTAGTTTTTGTCTTTTGTTTTGGTTGCTGATTTTTTTTCTATTTTTCTTTTTCTTTTCTTTTTGTTTTTTCCTTTTTTTTTTTTTTTTTTTTTT

TTTGGAGAGGGGTTGGATTTGTTGGTTTCATTAAACATTTAACTACCTGTAAAATATAAACATGGCTGTTAGTGTCACACCAATTCGGGACACAAAATGG

CTAACACTGGAAGTATGTAGAGAGTTTCAAAGGGGGACTTGCTCACGACCAGACACGGAATGTAAATTTGCACATCCTTCGAAAAGCTGCCAAGTTGAAA

ATGGACGAGTAATCGCCTGCTTTGATTCACTGAAA - UNI4392 - GGTCGTTGCTCCAGAGAGAACTGCAAATATCTTCATCCACCCCCACACTTAA

AAACACAGTTAGAGATAAATGGGCGGAATAACTTGATTCAGCAGAAGAACATGGCCATGCTGGCCCAGCAAATGCAGTTAGCCAATGCCATGATGCCCGG

TGCCCCGTTGCAGCCCGTG CCAATGTTTTCAGTTGCACCAAGCTTAGCCACCAGTGCATCAGCAGCCTTTAACCCTTACCTGGGGCCTGTTTCCCCAAG

CCTGGTTCCAGCAGAGATCTTGCCGACTGCACCAATGTTGGTCACGGGGAATCCTGGAGTTCCAGTGCCAGCAGCTGCCGCAGCTGCTGCACAGAAGTTA

ATGCGGACAGACAGACTGGAG GTGTGTCGAGAGTACCAGCGTGGCAATTGCAACAGAGGAGAAAATGACTGTCGGTTTGCTCATCCTGCTGACAGCACA

ATGATTGATACCAATGACAACACAGTCACTGTCTGCATGGATTACATCAAGGGGAGATGCTCTCGGGAAAAGTGCAAATACTTCCATCCTCCCGCACACC

TGCAAGCCAAGATCAAGGCTGCCCAATACCAGGTCAACCAGGCTGCAGCAGCACAGGCTGCAGCTACTGCAGCTGCCATG GGAATTCCTCAAGCTGTAC

TTCCCCCATTGCCAAAGAGGCCTGCTCTTGAAAAAACCAACGGTGCCACCGCAGTCTTTAACACTGGTATTTTCCAATACCAACAGGCTCTAGCCAACAT

GCAGTTACAGCAGCATACAGCATTTCTCCCACCAG - UNI715 - GCTCAATATTGTGCATGACACCCGCTACAAGTGTTG ATACCCATAATATCTG

CCGAACATCTGACTAGCCACAAGTATGTTACCCAGATGTAGAGCTGTCGTCACAAAACA ATCATACAAAGAGGAAAGGACAGTGTGCTTGATTAGAGTA

AGGACGACGTCATTAGCCATATTGTATATACCGTCAAGCAACACATACAAAAATCCCTCAGCCACAAGACATCCACATATTGCATGTTAACCAGAAGAAA

CGACAACATGGGAACCTGCTGCACACTGTTGCCTACACACTTTGTACATTCAGTTGGTATTTGTGCTGAGGTGATATTCCTATCTAAAACAACAACATTG

TCTTTCTTTTGTAGCACAGAGTTATGCATTAAAATATGCATACGTAATTAGTTTCCTATATATTCATGCCATCTTGAAAAGACAGACTATGGTGTGACCA

TGATTCTATTATGTATTGGTACGTCTGTAGACCAAGATATAATTTTTTAAAAATAAGTTTATTTCTTTCAAGGTTTACAAGTAACCAAGGTGCACCTTGT

ATTTAAAATCGCCGTTAGAGCTGAGAGCGCGCATGCAGAGTCATTTTTGTTTGAGAGTAATATTTTTACTGTAATAGATTGTACGACATGGTGAGGGAGG

GAACTGACAGATGAATGTGCCAAGCAAAACCACAACTGTGTATATTTTAAAGCACACCATGGCTTTAAGTACCATGTTGTTAAGGATTCTCATGAAGTGC

CATAGACTGTACATCAAATTAGAGTATTATTTCTTCAGTGTTATTGTTTCTGGAGCCACATTTTGTTGCTTATTTGCTAGTACTAATCAATCAAAGGGCA

CCATTCTTTTCTTTTTTGTTTTTGAAACCAAAGCTGTCTCAGAAATGGCCAATTTAACTTTACAGTAACAATAGACAGCACAACACAAACTCAATACAGA

TAACCTTTCACATACTGGAGATATATATGATAGATATATAAAATTATTTTAATGCATTGTAGTGTAATATTTATGCATACTCTACTATATAACATGTTAT

TCAAAAGGGATATGCCATTTCTGAGACACAATAACAAAAAATGTTTGAGGAAATTATTTTGCTTCTATTTATAGCCTCTGTCAAAAGTCAAAAGACTATA

AATGCTTTGCAGAAATGGGTTCACGTTTGCTTAAACGCTTCATCACAGTCACATTCAAAATAGTGACTCTAAACAAAGAGAACAGCACTGTCATCAGATG

CATGATAAACCAAAATATGAAAATGGGAAATGTTTAATTAACCTAGTAATTGGGTGGGTTAAGTACATGGGTGAATTTTATATGTGATTCTTTTGTTCAG

ATTAACTGCTTATAGCCTTAGAAAGCCTTTTAAAAAATTTTAAAAATAGATGTGCATTCAGTTTTTAAGAATGGATTCATCCAAAGGAATTCCCCTTTTT

TGTGGTTTGGATGTTGCAGCTAGGAAAGGCTATTTTTGCTCTGTTCAGCAGTTCTAAAATCGCTGAGTAGGGGCCAGGTCACTGGCAGTTCTAGTGTGGA

ATGGGAGAAGTGAGAGTTCTGTTATAGAACTTTCCATACTTCCAAGTTTACTGCAAGTTTTTATGCTTGAGAGAGATGCTTTCTAATATAAGACTGATGT

GTTGATTTTCCTGATTGTACTGTACATCTATTAAAGCCTTAGATTATTACATTACGGGTTGGAACCCATACCAATGTAATTTCAATCGTGTTAAGAGAGT

AATGGTGACTTCACATGTTATTGTAGTTAGTTACGTTATAGAATATTACTTATTTTTCTTGTTAAAATGTAGTTTTTCATTTCCTACATTTATTGGATTT

TCATTTTCTATTAACAGTTGAATACCATTTCAGTTTTTAGACTATTGTTTTATTAGATTTTACCAATGAATTTTTCAAAATACAAAAAAATTAAAGTAGT

TTTTTCTTCATAACATACTCAGTTTTAAATTACATGTAGTGTCATATGAATATCCGTATTATTGTTAACTAAATGATTTATATTTTACTGATTTAATATT

ACAGTGTAAGAATGTCAGTCATTGTTCTTGTCTAGTTTTCATTAAAAGAACAAAGATCTTTTATATGGATATCTTATAAATATATAATCATTGCTAAGTA

AGAAGTTAAGTTGTTGCTATGGCAACAATCCTGGCAGACAATTGAGTAATATTTTGATGATTTATTTTGTTTGTAATTAGTTATTATGAGAAGATCTAGA

TCCTAGATATTAGAATAAAATTTATTTTCTACTGTATCCATTTCAAATGTTAAAGTATTGTTTAATATTTTTGAAATCCCTGAATATCAGGCCTTGTTAT

AAATAAGCTGCATAATCAATAAATAGAACAAGGGACTTTTTGTTGATAATCCAAATACTCAAAGTTTACGTAATGAGAATTTTAGCGTGTGTGCAAACTC

TTGAGGGTTGATGATGCTGCAATTTAGCATGTTGGAAAGTCTAGAGAGAAGGTTGACTTTTTGCACTTCTGTATATAGTCAAAAGAGAGAAACCTGTATA

ATAGCAAGATCTTATTTTGAATAAAAACGTCTATAATTACAAGGAGTTTTGTTAAGGCTAATGAAATGACAGACTGAGCAAAATTGCTTGCAAAAGTGGC

ACAGAGTTAGCACTCCATACCCTTCAAACACGTCGCTTTGCTTTTTGTGGACAGCTTGTAGTTTGCCAGGATTTTTCAGCTGGAAAGATTTGCCATCCTT

CCAAGATCTCATGACTGACAAAACTCCATTGGGCCAAATCTGCCTGAAGATCATTACCAAAAAATAGCAGGTACTTCAGCCACTAAGATGAAATCATGGA

TCAGATATCCCTTACATTGTTTTCAAAACTACTGCATGTTTAAAACTTCAACAAAAAGAGAGAAAGAACTATGCTAAGGACATATATTATTCAGATCGAT

ATCTACCAATTTCAGTGGTTTAATGTTCACAAAATGAAATCTTGAAAATAACTATTGACTTTCACAAAATTTTAACCATAAACAGGCAAACCAAACAGCA

CACCTGTAGTTGTTCTGTGATTGTTTTTTAATTGCTGTAGATCATGTTCTTTCCGCAGGTGGAAAAAAAAAAAAAAAAAAAAAAAGAAGTTCAAATTTCA

CAGTTTTAATTTTCAACTCAGAAGCAAAAGAGCAAAATGTGACAATGGCCACTTGTTTAATGACTTGGTTGCCCAGCTGTCACTGCAGCTGGCTACTGAT

GTTGCACTTACCAGCAACCCACCCACCTTCATCTGCCGAAAGGACAGTGAGCTTGGTTTTACGATTATGTAATCACAACTTACTTTCTGCTTGTAGTGGC

TTAAAATTATGTATTTTGTCTAGGGCTGCAATTTGTTTTATGCTTACTTTATTATTACTGCAGTAGTTGACTTTGCTGTATGGAAAAATAAAGCGAAATT

GCCCTAATAAAACTTCTCTTTCTTAAGTA
Translation
 - UNI31967 - MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLK - UNI4392 - GRCSRENCKYLHPPP

HLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPV PMFSVAPSLATSASAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAA

QKLMRTDRLE VCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAM GI

PQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPG - UNI715 - GSILCMTPATSVD DTHNICRTSD 
Transcript ENSMUST00000099087
Sequence
GGCGACATGCCACAGTCTCTCGCCGCAGCCCGTCGAGTCGGGGCGCTCGCCATGCTCCCGTGACCCGGACCCGGCCAGTTCCCTTTCCCGTGGCGGGCAT

CCCGGAGTCGCGATCCCACAATGCCCCGGGCAGTCGGGGCCCCGGCGGGCAGCCTGCACGGCCACGTGAGAG - UNI31967 - GTTGGTACTAAGAA

GTGCCTTTCCTGACGTCTCTGCTGCTTGGAACCGCTTCTAGAGCAGCCTCTGCTTTTGCCTTGCTTGCTGCCAGCTAGACTGACGACAGCACATCCGCCC

TCCACCTCTAGCCCAGACACCCCATTTCTACTTCTAATCAGGAGAAAAGCTCTGAGTATCTGCCATTGCCCTAGGCTGCTTTAGTTTAGAAGAAAAGTTT

GCTGAAAAAGTAAGATACCTTCTGCCAGGAAATCAAGGAGGAAAAAAAAAAATCATTTTCTCGATTTTGCTCTAAACTGCTGCATCTGTCTATGCCAAAC

TAATCAATACCGATTGCACCACCAAACTCCATCGCAAATCAGCTGTGAGGAGATTCCCTGTCAGACAACTTTGCTGAAAGCAGCTTGGAAATTCGGTGTC

AAAGGGTCTGCCACGTTTTCATGCTTGCATTTTGGGCTCCAAATTGGCACTGGGAAGGGGTTACTGAGCACACGGCTGAGTCCAGGCCTCCTCTAAACAC

CCATCTACTTACAGTCCTGGTATTCCTCTCAAAACCAAAACCTCTTTGAATTAACAGTTTCATGCTGTGAATTTCTAGCGGAGGTCTTTCCCTTTATATT

GAAGTCACACTTTTCCATGTGCCGTTAAATCGGGGACGGGGGAAGCAGCCTTTCGGACATTTTCACAGTTATCTCACACTCTGAGTTTTATCAGTTCCTA

TTTTGTTTAGTTTTTGTCTTTTGTTTTGGTTGCTGATTTTTTTTCTATTTTTCTTTTTCTTTTCTTTTTGTTTTTTCCTTTTTTTTTTTTTTTTTTTTTT

TTTGGAGAGGGGTTGGATTTGTTGGTTTCATTAAACATTTAACTACCTGTAAAATATAAACATGGCTGTTAGTGTCACACCAATTCGGGACACAAAATGG

CTAACACTGGAAGTATGTAGAGAGTTTCAAAGGGGGACTTGCTCACGACCAGACACGGAATGTAAATTTGCACATCCTTCGAAAAGCTGCCAAGTTGAAA

ATGGACGAGTAATCGCCTGCTTTGATTCACTGAAA - UNI4392 - GGTCGTTGCTCCAGAGAGAACTGCAAATATCTTCATCCACCCCCACACTTAA

AAACACAGTTAGAGATAAATGGGCGGAATAACTTGATTCAGCAGAAGAACATGGCCATGCTGGCCCAGCAAATGCAGTTAGCCAATGCCATGATGCCCGG

TGCCCCGTTGCAGCCCGTG CCAATGTTTTCAGTTGCACCAAGCTTAGCCACCAGTGCATCAGCAGCCTTTAACCCTTACCTGGGGCCTGTTTCCCCAAG

CCTGGTTCCAGCAGAGATCTTGCCGACTGCACCAATGTTGGTCACGGGGAATCCTGGAGTTCCAGTGCCAGCAGCTGCCGCAGCTGCTGCACAGAAGTTA

ATGCGGACAGACAGACTGGAG GTGTGTCGAGAGTACCAGCGTGGCAATTGCAACAGAGGAGAAAATGACTGTCGGTTTGCTCATCCTGCTGACAGCACA

ATGATTGATACCAATGACAACACAGTCACTGTCTGCATGGATTACATCAAGGGGAGATGCTCTCGGGAAAAGTGCAAATACTTCCATCCTCCCGCACACC

TGCAAGCCAAGATCAAGGCTGCCCAATACCAGGTCAACCAGGCTGCAGCAGCACAGGCTGCAGCTACTGCAGCTGCCATG GGAATTCCTCAAGCTGTAC

TTCCCCCATTGCCAAAGAGGCCTGCTCTTGAAAAAACCAACGGTGCCACCGCAGTCTTTAACACTGGTATTTTCCAATACCAACAGGCTCTAGCCAACAT

GCAGTTACAGCAGCATACAGCATTTCTCCCACCAG - UNI715 - GCTCAATATTGTGCATGACACCCGCTACAAGTGTTG TTCCCATGGTGCACGG

TGCTACGCCAGCCACTGTGTCCGCAGCAACAACATCTGCCACAAGTGTTCCCTTCGCTGCAACAGCCACAGCCAACCAG ATACCCATAATATCTGCCGA

ACATCTGACTAGCCACAAGTATGTTACCCAGATGTAGAGCTGTCGTCACAAAACA ATCATACAAAGAGGAAAGGACAGTGTGCTTGATTAGAGTAAGGA

CGACGTCATTAGCCATATTGTATATACCGTCAAGCAACACATACAAAAATCCCTCAGCCACAAGACATCCACATATTGCATGTTAACCAGAAGAAACGAC

AACATGGGAACCTGCTGCACACTGTTGCCTACACACTTTGTACATTCAGTTGGTATTTGTGCTGAGGTGATATTCCTATCTAAAACAACAACATTGTCTT

TCTTTTGTAGCACAGAGTTATGCATTAAAATATGCATACGTAATTAGTTTCCTATATATTCATGCCATCTTGAAAAGACAGACTATGGTGTGACCATGAT

TCTATTATGTATTGGTACGTCTGTAGACCAAGATATAATTTTTTAAAAATAAGTTTATTTCTTTCAAGGTTTACAAGTAACCAAGGTGCACCTTGTATTT

AAAATCGCCGTTAGAGCTGAGAGCGCGCATGCAGAGTCATTTTTGTTTGAGAGTAATATTTTTACTGTAATAGATTGTACGACATGGTGAGGGAGGGAAC

TGACAGATGAATGTGCCAAGCAAAACCACAACTGTGTATATTTTAAAGCACACCATGGCTTTAAGTACCATGTTGTTAAGGATTCTCATGAAGTGCCATA

GACTGTACATCAAATTAGAGTATTATTTCTTCAGTGTTATTGTTTCTGGAGCCACATTTTGTTGCTTATTTGCTAGTACTAATCAATCAAAGGGCACCAT

TCTTTTCTTTTTTGTTTTTGAAACCAAAGCTGTCTCAGAAATGGCCAATTTAACTTTACAGTAACAATAGACAGCACAACACAAACTCAATACAGATAAC

CTTTCACATACTGGAGATATATATGATAGATATATAAAATTATTTTAATGCATTGTAGTGTAATATTTATGCATACTCTACTATATAACATGTTATTCAA

AAGGGATATGCCATTTCTGAGACACAATAACAAAAAATGTTTGAGGAAATTATTTTGCTTCTATTTATAGCCTCTGTCAAAAGTCAAAAGACTATAAATG

CTTTGCAGAAATGGGTTCACGTTTGCTTAAACGCTTCATCACAGTCACATTCAAAATAGTGACTCTAAACAAAGAGAACAGCACTGTCATCAGATGCATG

ATAAACCAAAATATGAAAATGGGAAATGTTTAATTAACCTAGTAATTGGGTGGGTTAAGTACATGGGTGAATTTTATATGTGATTCTTTTGTTCAGATTA

ACTGCTTATAGCCTTAGAAAGCCTTTTAAAAAATTTTAAAAATAGATGTGCATTCAGTTTTTAAGAATGGATTCATCCAAAGGAATTCCCCTTTTTTGTG

GTTTGGATGTTGCAGCTAGGAAAGGCTATTTTTGCTCTGTTCAGCAGTTCTAAAATCGCTGAGTAGGGGCCAGGTCACTGGCAGTTCTAGTGTGGAATGG

GAGAAGTGAGAGTTCTGTTATAGAACTTTCCATACTTCCAAGTTTACTGCAAGTTTTTATGCTTGAGAGAGATGCTTTCTAATATAAGACTGATGTGTTG

ATTTTCCTGATTGTACTGTACATCTATTAAAGCCTTAGATTATTACATTACGGGTTGGAACCCATACCAATGTAATTTCAATCGTGTTAAGAGAGTAATG

GTGACTTCACATGTTATTGTAGTTAGTTACGTTATAGAATATTACTTATTTTTCTTGTTAAAATGTAGTTTTTCATTTCCTACATTTATTGGATTTTCAT

TTTCTATTAACAGTTGAATACCATTTCAGTTTTTAGACTATTGTTTTATTAGATTTTACCAATGAATTTTTCAAAATACAAAAAAATTAAAGTAGTTTTT

TCTTCATAACATACTCAGTTTTAAATTACATGTAGTGTCATATGAATATCCGTATTATTGTTAACTAAATGATTTATATTTTACTGATTTAATATTACAG

TGTAAGAATGTCAGTCATTGTTCTTGTCTAGTTTTCATTAAAAGAACAAAGATCTTTTATATGGATATCTTATAAATATATAATCATTGCTAAGTAAGAA

GTTAAGTTGTTGCTATGGCAACAATCCTGGCAGACAATTGAGTAATATTTTGATGATTTATTTTGTTTGTAATTAGTTATTATGAGAAGATCTAGATCCT

AGATATTAGAATAAAATTTATTTTCTACTGTATCCATTTCAAATGTTAAAGTATTGTTTAATATTTTTGAAATCCCTGAATATCAGGCCTTGTTATAAAT

AAGCTGCATAATCAATAAATAGAACAAGGGACTTTTTGTTGATAATCCAAATACTCAAAGTTTACGTAATGAGAATTTTAGCGTGTGTGCAAACTCTTGA

GGGTTGATGATGCTGCAATTTAGCATGTTGGAAAGTCTAGAGAGAAGGTTGACTTTTTGCACTTCTGTATATAGTCAAAAGAGAGAAACCTGTATAATAG

CAAGATCTTATTTTGAATAAAAACGTCTATAATTACAAGGAGTTTTGTTAAGGCTAATGAAATGACAGACTGAGCAAAATTGCTTGCAAAAGTGGCACAG

AGTTAGCACTCCATACCCTTCAAACACGTCGCTTTGCTTTTTGTGGACAGCTTGTAGTTTGCCAGGATTTTTCAGCTGGAAAGATTTGCCATCCTTCCAA

GATCTCATGACTGACAAAACTCCATTGGGCCAAATCTGCCTGAAGATCATTACCAAAAAATAGCAGGTACTTCAGCCACTAAGATGAAATCATGGATCAG

ATATCCCTTACATTGTTTTCAAAACTACTGCATGTTTAAAACTTCAACAAAAAGAGAGAAAGAACTATGCTAAGGACATATATTATTCAGATCGATATCT

ACCAATTTCAGTGGTTTAATGTTCACAAAATGAAATCTTGAAAATAACTATTGACTTTCACAAAATTTTAACCATAAACAGGCAAACCAAACAGCACACC

TGTAGTTGTTCTGTGATTGTTTTTTAATTGCTGTAGATCATGTTCTTTCCGCAGGTGGAAAAAAAAAAAAAAAAAAAAAAAGAAGTTCAAATTTCACAGT

TTTAATTTTCAACTCAGAAGCAAAAGAGCAAAATGTGACAATGGCCACTTGTTTAATGACTTGGTTGCCCAGCTGTCACTGCAGCTGGCTACTGATGTTG

CACTTACCAGCAACCCACCCACCTTCATCTGCCGAAAGGACAGTGAGCTTGGTTTTACGATTATGTAATCACAACTTACTTTCTGCTTGTAGTGGCTTAA

AATTATGTATTTTGTCTAGGGCTGCAATTTGTTTTATGCTTACTTTATTATTACTGCAGTAGTTGACTTTGCTGTATGGAAAAATAAAGCGAAATTGCCC

TAATAAAACTTCTCTTTCTTAAGTA
Translation
 - UNI31967 - MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLK - UNI4392 - GRCSRENCKYLHPPP

HLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPV PMFSVAPSLATSASAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAA

QKLMRTDRLE VCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAM GI

PQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPG - UNI715 - GSILCMTPATSVV VPMVHGATPATVSAATTSATSVPF

AATATANQ IPIISAEHLTSHKYVTQM 
Transcript ENSMUST00000029327
Sequence
GGCGACATGCCACAGTCTCTCGCCGCAGCCCGTCGAGTCGGGGCGCTCGCCATGCTCCCGTGACCCGGACCCGGCCAGTTCCCTTTCCCGTGGCGGGCAT

CCCGGAGTCGCGATCCCACAATGCCCCGGGCAGTCGGGGCCCCGGCGGGCAGCCTGCACGGCCACGTGAGAG - UNI31967 - GTTGGTACTAAGAA

GTGCCTTTCCTGACGTCTCTGCTGCTTGGAACCGCTTCTAGAGCAGCCTCTGCTTTTGCCTTGCTTGCTGCCAGCTAGACTGACGACAGCACATCCGCCC

TCCACCTCTAGCCCAGACACCCCATTTCTACTTCTAATCAGGAGAAAAGCTCTGAGTATCTGCCATTGCCCTAGGCTGCTTTAGTTTAGAAGAAAAGTTT

GCTGAAAAAGTAAGATACCTTCTGCCAGGAAATCAAGGAGGAAAAAAAAAAATCATTTTCTCGATTTTGCTCTAAACTGCTGCATCTGTCTATGCCAAAC

TAATCAATACCGATTGCACCACCAAACTCCATCGCAAATCAGCTGTGAGGAGATTCCCTGTCAGACAACTTTGCTGAAAGCAGCTTGGAAATTCGGTGTC

AAAGGGTCTGCCACGTTTTCATGCTTGCATTTTGGGCTCCAAATTGGCACTGGGAAGGGGTTACTGAGCACACGGCTGAGTCCAGGCCTCCTCTAAACAC

CCATCTACTTACAGTCCTGGTATTCCTCTCAAAACCAAAACCTCTTTGAATTAACAGTTTCATGCTGTGAATTTCTAGCGGAGGTCTTTCCCTTTATATT

GAAGTCACACTTTTCCATGTGCCGTTAAATCGGGGACGGGGGAAGCAGCCTTTCGGACATTTTCACAGTTATCTCACACTCTGAGTTTTATCAGTTCCTA

TTTTGTTTAGTTTTTGTCTTTTGTTTTGGTTGCTGATTTTTTTTCTATTTTTCTTTTTCTTTTCTTTTTGTTTTTTCCTTTTTTTTTTTTTTTTTTTTTT

TTTGGAGAGGGGTTGGATTTGTTGGTTTCATTAAACATTTAACTACCTGTAAAATATAAACATGGCTGTTAGTGTCACACCAATTCGGGACACAAAATGG

CTAACACTGGAAGTATGTAGAGAGTTTCAAAGGGGGACTTGCTCACGACCAGACACGGAATGTAAATTTGCACATCCTTCGAAAAGCTGCCAAGTTGAAA

ATGGACGAGTAATCGCCTGCTTTGATTCACTGAAA - UNI4392 - GGTCGTTGCTCCAGAGAGAACTGCAAATATCTTCATCCACCCCCACACTTAA

AAACACAGTTAGAGATAAATGGGCGGAATAACTTGATTCAGCAGAAGAACATGGCCATGCTGGCCCAGCAAATGCAGTTAGCCAATGCCATGATGCCCGG

TGCCCCGTTGCAGCCCGTG CCAATGTTTTCAGTTGCACCAAGCTTAGCCACCAGTGCATCAGCAGCCTTTAACCCTTACCTGGGGCCTGTTTCCCCAAG

CCTGGTTCCAGCAGAGATCTTGCCGACTGCACCAATGTTGGTCACGGGGAATCCTGGAGTTCCAGTGCCAGCAGCTGCCGCAGCTGCTGCACAGAAGTTA

ATGCGGACAGACAGACTGGAG GTGTGTCGAGAGTACCAGCGTGGCAATTGCAACAGAGGAGAAAATGACTGTCGGTTTGCTCATCCTGCTGACAGCACA

ATGATTGATACCAATGACAACACAGTCACTGTCTGCATGGATTACATCAAGGGGAGATGCTCTCGGGAAAAGTGCAAATACTTCCATCCTCCCGCACACC

TGCAAGCCAAGATCAAGGCTGCCCAATACCAGGTCAACCAGGCTGCAGCAGCACAGGCTGCAGCTACTGCAGCTGCCATG GGAATTCCTCAAGCTGTAC

TTCCCCCATTGCCAAAGAGGCCTGCTCTTGAAAAAACCAACGGTGCCACCGCAGTCTTTAACACTGGTATTTTCCAATACCAACAGGCTCTAGCCAACAT

GCAGTTACAGCAGCATACAGCATTTCTCCCACCAG - UNI715 - GCTCAATATTGTGCATGACACCCGCTACAAGTGTTG TTCCCATGGTGCACGG

TGCTACGCCAGCCACTGTGTCCGCAGCAACAACATCTGCCACAAGTGTTCCCTTCGCTGCAACAGCCACAGCCAACCAG ATACCCATAATATCTGCCGA

ACATCTGACTAGCCACAAGTATGTTACCCAGATGTAGAGCTGTCGTCACAAAACA ATCATACAAAGAGGAAAGGACAGTGTGCTTGATTAGAGTAAGGA

CGACGTCATTAGCCATATTGTATATACCGTCAAGCAACACATACAAAAATCCCTCAGCCACAAGACATCCACATATTGCATGTTAACCAGAAGAAACGAC

AACATGGGAACCTGCTGCACACTGTTGCCTACACACTTTGTACATTCAGTTGGTATTTGTGCTGAGGTGATATTCCTATCTAAAACAACAACATTGTCTT

TCTTTTGTAGCACAGAGTTATGCATTAAAATATGCATACGTAATTAGTTTCCTATATATTCATGCCATCTTGAAAAGACAGACTATGGTGTGACCATGAT

TCTATTATGTATTGGTACGTCTGTAGACCAAGATATAATTTTTTAAAAATAAGTTTATTTCTTTCAAGGTTTACAAGTAACCAAGGTGCACCTTGTATTT

AAAATCGCCGTTAGAGCTGAGAGCGCGCATGCAGAGTCATTTTTGTTTGAGAGTAATATTTTTACTGTAATAGATTGTACGACATGGTGAGGGAGGGAAC

TGACAGATGAATGTGCCAAGCAAAACCACAACTGTGTATATTTTAAAGCACACCATGGCTTTAAGTACCATGTTGTTAAGGATTCTCATGAAGTGCCATA

GACTGTACATCAAATTAGAGTATTATTTCTTCAGTGTTATTGTTTCTGGAGCCACATTTTGTTGCTTATTTGCTAGTACTAATCAATCAAAGGGCACCAT

TCTTTTCTTTTTTGTTTTTGAAACCAAAGCTGTCTCAGAAATGGCCAATTTAACTTTACAGTAACAATAGACAGCACAACACAAACTCAATACAGATAAC

CTTTCACATACTGGAGATATATATGATAGATATATAAAATTATTTTAATGCATTGTAGTGTAATATTTATGCATACTCTACTATATAACATGTTATTCAA

AAGGGATATGCCATTTCTGAGACACAATAACAAAAAATGTTTGAGGAAATTATTTTGCTTCTATTTATAGCCTCTGTCAAAAGTCAAAAGACTATAAATG

CTTTGCAGAAATGGGTTCACGTTTGCTTAAACGCTTCATCACAGTCACATTCAAAATAGTGACTCTAAACAAAGAGAACAGCACTGTCATCAGATGCATG

ATAAACCAAAATATGAAAATGGGAAATGTTTAATTAACCTAGTAATTGGGTGGGTTAAGTACATGGGTGAATTTTATATGTGATTCTTTTGTTCAGATTA

ACTGCTTATAGCCTTAGAAAGCCTTTTAAAAAATTTTAAAAATAGATGTGCATTCAGTTTTTAAGAATGGATTCATCCAAAGGAATTCCCCTTTTTTGTG

GTTTGGATGTTGCAGCTAGGAAAGGCTATTTTTGCTCTGTTCAGCAGTTCTAAAATCGCTGAGTAGGGGCCAGGTCACTGGCAGTTCTAGTGTGGAATGG

GAGAAGTGAGAGTTCTGTTATAGAACTTTCCATACTTCCAAGTTTACTGCAAGTTTTTATGCTTGAGAGAGATGCTTTCTAATATAAGACTGATGTGTTG

ATTTTCCTGATTGTACTGTACATCTATTAAAGCCTTAGATTATTACATTACGGGTTGGAACCCATACCAATGTAATTTCAATCGTGTTAAGAGAGTAATG

GTGACTTCACATGTTATTGTAGTTAGTTACGTTATAGAATATTACTTATTTTTCTTGTTAAAATGTAGTTTTTCATTTCCTACATTTATTGGATTTTCAT

TTTCTATTAACAGTTGAATACCATTTCAGTTTTTAGACTATTGTTTTATTAGATTTTACCAATGAATTTTTCAAAATACAAAAAAATTAAAGTAGTTTTT

TCTTCATAACATACTCAGTTTTAAATTACATGTAGTGTCATATGAATATCCGTATTATTGTTAACTAAATGATTTATATTTTACTGATTTAATATTACAG

TGTAAGAATGTCAGTCATTGTTCTTGTCTAGTTTTCATTAAAAGAACAAAGATCTTTTATATGGATATCTTATAAATATATAATCATTGCTAAGTAAGAA

GTTAAGTTGTTGCTATGGCAACAATCCTGGCAGACAATTGAGTAATATTTTGATGATTTATTTTGTTTGTAATTAGTTATTATGAGAAGATCTAGATCCT

AGATATTAGAATAAAATTTATTTTCTACTGTATCCATTTCAAATGTTAAAGTATTGTTTAATATTTTTGAAATCCCTGAATATCAGGCCTTGTTATAAAT

AAGCTGCATAATCAATAAATAGAACAAGGGACTTTTTGTTGATAATCCAAATACTCAAAGTTTACGTAATGAGAATTTTAGCGTGTGTGCAAACTCTTGA

GGGTTGATGATGCTGCAATTTAGCATGTTGGAAAGTCTAGAGAGAAGGTTGACTTTTTGCACTTCTGTATATAGTCAAAAGAGAGAAACCTGTATAATAG

CAAGATCTTATTTTGAATAAAAACGTCTATAATTACAAGGAGTTTTGTTAAGGCTAATGAAATGACAGACTGAGCAAAATTGCTTGCAAAAGTGGCACAG

AGTTAGCACTCCATACCCTTCAAACACGTCGCTTTGCTTTTTGTGGACAGCTTGTAGTTTGCCAGGATTTTTCAGCTGGAAAGATTTGCCATCCTTCCAA

GATCTCATGACTGACAAAACTCCATTGGGCCAAATCTGCCTGAAGATCATTACCAAAAAATAGCAGGTACTTCAGCCACTAAGATGAAATCATGGATCAG

ATATCCCTTACATTGTTTTCAAAACTACTGCATGTTTAAAACTTCAACAAAAAGAGAGAAAGAACTATGCTAAGGACATATATTATTCAGATCGATATCT

ACCAATTTCAGTGGTTTAATGTTCACAAAATGAAATCTTGAAAATAACTATTGACTTTCACAAAATTTTAACCATAAACAGGCAAACCAAACAGCACACC

TGTAGTTGTTCTGTGATTGTTTTTTAATTGCTGTAGATCATGTTCTTTCCGCAGGTGGAAAAAAAAAAAAAAAAAAAAAAAGAAGTTCAAATTTCACAGT

TTTAATTTTCAACTCAGAAGCAAAAGAGCAAAATGTGACAATGGCCACTTGTTTAATGACTTGGTTGCCCAGCTGTCACTGCAGCTGGCTACTGATGTTG

CACTTACCAGCAACCCACCCACCTTCATCTGCCGAAAGGACAGTGAGCTTGGTTTTACGATTATGTAATCACAACTTACTTTCTGCTTGTAGTGGCTTAA

AATTATGTATTTTGTCTAGGGCTGCAATTTGTTTTATGCTTACTTTATTATTACTGCAGTAGTTGACTTTGCTGTATGGAAAAATAAAGCGAAATTGCCC

TAATAAAACTTCTCTTTCTTAAGTA
Translation
 - UNI31967 - NINMAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLK - UNI4392 - GRCSRENCKYLH

PPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPV PMFSVAPSLATSASAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAA

AAAQKLMRTDRLE VCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAM

 GIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPG - UNI715 - GSILCMTPATSVV VPMVHGATPATVSAATTSATS

VPFAATATANQ IPIISAEHLTSHKYVTQM 

For any suggestions or comments, please send an email to unitrap@crg.es