Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027787 (Nmd3)
Chromosomal location
Chr 3: 69526009 - 69552964 (+)
Description
NMD3 homolog (S. cerevisiae) Gene [Source:MGI (curated);Acc:Nmd3-001]
RefSeq_dna
NM_133787 
RefSeq_peptide
NP_598548.1 
UniGene
Mm.468983 
MGI
MGI:2140103 
Uniprot/SWISSPROT
Q99L48 
Human Ortholog
ENSG00000169251 (NMD3)
Omim not available
UniTrap UNI12090
Vector Insertion
Chr 3: 69526389 - 69528178
Public Clones W248B04 (ggtc) IST14413G2 (tigm)
Private Clones OST246797 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37591
Vector Insertion
Chr 3: 69528314 - 69530282
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12972
Vector Insertion
Chr 3: 69530380 - 69533259
Public Clones CMHD-GT_355C4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27758
Vector Insertion
Chr 3: 69533341 - 69534326
Public Clones not available
Private Clones OST50126 (lexicon) OST50125 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27759
Vector Insertion
Chr 3: 69534456 - 69535486
Public Clones not available
Private Clones OST50124 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12591
Vector Insertion
Chr 3: 69535578 - 69538967
Public Clones W177A02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31012
Vector Insertion
Chr 3: 69540012 - 69543841
Public Clones IST11174E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20486
Vector Insertion
Chr 3: 69545577 - 69547437
Public Clones not available
Private Clones OST360883 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029358
Sequence
GCTGTGGGTGTATTTCGCCCTGTCACGGAGCTGCTG GTCGCGCGCGAACCATGGAGTACATGGCAGAGTCCATTGAGCACAGCCCGGGACACAT - UN

I12090 - CTTGTGCTGTGAATGTGGTGTCCCAATTAGTCCAAATCCTGCCAATATTTGTGTGGCCTGTTTACGAAGTAAAGTTGACATCAGCCAAGGT

GTTCCAAAGCAGGTCTCCATTTCTTTCTGCAAACAGTGTCAGAG ATATTTTCAGCCACCAGCATCATGGGTACAGTGTGCTTTAGAGTCCAGGGAACTT

CTTGCTTTGTGTTTGAAAAAAATTAAAGCTCCTCTGAGTAAG - UNI12972 - GTTCGGCTTGTCGATGCAGGCTTTGTTTGGACTGAGCCCCATTC

CAAGAGACTTAAAGTTAAATTGACAATTCAGAAAGAG - UNI27758 - GTGATGAATGGTGCTATCCTGCAGCAAGTGTTTGTGGTGGATTATGTTG

TTCAGTCCCAAATGTGTGGAGACTGCCATAGAGTGGAAGCTAAGGATTTCTGGAAGGCTGTGATCCAAGTCAGGCAAAAG - UNI27759 - ACTCTA

CACAAGAAAACATTCTACTATCTGGAACAGTTGATTTTAAAATATGGAATGCATCAGAATACACTGCGTATCAAGGAGATTCATG - UNI12591 - A

TGGTCTGGATTTTTATTATTCTTCAAAACAGCATGCTCAGAAGATGGTGGAGTTTCTTCAGGGTATAGTTCCCTGTAG ATACAAAGCATCACAAAGATT

GATCTCTCAGGATATTCATAGTAACACATACAATTACAAGAGTACTTTTTCTGTGGAAATTGTTCCAATATGCAAG - UNI31012 - GATAATGTTG

TCTGTCTATCACCAAAACTGGCACAGAGCCTTGGAAATATGAGTCAGATATGTATTTGTATACGAGTAACTAGTGCCATCCACCTCATAGACCCAAATAC

CCTACAAG TTGCAGATATTGATGGAAACACTTTCTGGAGTCATCCTTTCAATAGTTTATGCCATCCTAAACAGCTCGAAGAGTTTATTGTGATAGAATG

CAGCACAGTCCGAGATCTGAAGCGAAGTGCGGGGGCTGGAGTGATATCAAAAAAG - UNI20486 - CACACCCTTGGGGAAGTCTGGATCCAGAAGA

CATCTGAAATGAATACAGATAAACAGTATTTTTGCCGAACTCACTTGGGACATCTTTTAAATCCTGGAGACCTGGTGCTGGG ATTTGATTTGGCCAACT

GTAACTTAAATGATGAGTATGTCAACAAAATGAACTCAGACAGAGTTCCAGATGTG GTGTTAATTAAGAAGAGCTATGACCGCACCAAACGCCAGCGCC

GTAGAAACTGGAAACTGAAAGAGCTTGCAAGAGACAGAGAAAACATGGACACAGATGATGAAAG GCAATATCAAGATTTTCTTGAAGATCTTGAAGAAG

ATGAGGCAATTAGAAAACATGTCAACATTTACAGAG ATGCAACCATCCCTGTGGAAAGTGACACAGATGATGAAGGAGCACCTCGAATTAGTCTGGCTG

AGATGCTTGAAGACCTTCATATTTCTCAAGATGCCACTGGTGAAGAAGGTGCATCAATGATGTCATGATGAGTCATATTATATGTTGCTTGCATATCTGT

GGCCTCAGGAAGTTGGCAAAAACCTTTATTGTACAGTACATATATTCCCTTATATTTTAAAAGAAATTTGACCTTAAACTTTAATAAATTACTATTTTAA

TTGTTCCC
Translation
 MEYMAESIEHSPGHI - UNI12090 - ILCCECGVPISPNPANICVACLRSKVDISQGVPKQVSISFCKQCQR RYFQPPASWVQCALESRELLALC

LKKIKAPLSK - UNI12972 - VRLVDAGFVWTEPHSKRLKVKLTIQKE - UNI27758 - VMNGAILQQVFVVDYVVQSQMCGDCHRVEAKDFWK

AVIQVRQK - UNI27759 - TLHKKTFYYLEQLILKYGMHQNTLRIKEIHD - UNI12591 - DGLDFYYSSKQHAQKMVEFLQGIVPCR RYKAS

QRLISQDIHSNTYNYKSTFSVEIVPICK - UNI31012 - DNVVCLSPKLAQSLGNMSQICICIRVTSAIHLIDPNTLQV VADIDGNTFWSHPFNSL

CHPKQLEEFIVIECSTVRDLKRSAGAGVISKK - UNI20486 - HTLGEVWIQKTSEMNTDKQYFCRTHLGHLLNPGDLVLG GFDLANCNLNDEYVN

KMNSDRVPDV VLIKKSYDRTKRQRRRNWKLKELARDRENMDTDDER RQYQDFLEDLEEDEAIRKHVNIYRD DATIPVESDTDDEGAPRISLAEMLED

LHISQDATGEEGASMMS

For any suggestions or comments, please send an email to unitrap@crg.es