Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027820 (Mme)
Chromosomal location
Chr 3: 63099794 - 63186153 (+)
Description
membrane metallo endopeptidase Gene [Source:MGI Symbol;Acc:MGI:97004]
RefSeq_dna
NM_008604 
RefSeq_peptide
NP_032630.2 
UniGene
Mm.422356 Mm.296022 
MGI
MGI:97004 
Uniprot/SWISSPROT
Q61391 
Uniprot/SPTREMBL
Q8BNU9 
Human Ortholog
ENSG00000196549 (MME)
Omim not available
UniTrap UNI17847
Vector Insertion
Chr 3: 63100245 - 63104046
Public Clones not available
Private Clones OST435003 (lexicon) OST434145 (lexicon) OST423708 (lexicon) OST417872 (lexicon)
OST310429 (lexicon) OST93346 (lexicon) OST65873 (lexicon) OST58014 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24541
Vector Insertion
Chr 3: 63104217 - 63104900
Public Clones not available
Private Clones OST216033 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9485
Vector Insertion
Chr 3: 63104937 - 63130635
Public Clones (sanger) RST377 (baygenomics) NST005 (baygenomics)
Private Clones OST406606 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32797
Vector Insertion
Chr 3: 63172879 - 63184154
Public Clones IST10252E2 (tigm) IST14329D6 (tigm) IST14639G2 (tigm) IST11922E4 (tigm)
IST14096B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107889
Sequence
TCATAGCTTCCTGCAGCCTCCGCCCAGGAGTTCTGTTTGGTGACCGAGAGCAGCGCTGCCAAATTGCACCGGGGTTCATTTGGGGGCTGGGAATTGGCCA

TTCCGCTGTACAGACACTGTTTTTATTTTAAAAAACAAG - UNI17847 - ATTTTAGGTGATGGGAAGATCAGAAAGTCAGATGGATATAACTGATA

TCAATGCTCCAAAGCCAAAGAAGAAACAGCGATGGACTCCCCTGGAGATCAGCCTCTCTGTGCTTGTCTTGCTCCTGACTATCATAGCGGTGACAATGAT

CGCTCTCTATGCAACCTATGATG - UNI24541 - ATGGCATTTGCAAATCATCAGACTGCATAAAATCAG - UNI9485 - CTGCTCGACTGATT

CAGAATATGGATGCCTCTGTTGAGCCATGTACAGACTTCTTCAAGTATGCTTGTGGAGGCTGGTTGAAACGCAACGTCATTCCCGAGACCAGTTCCCGAT

ACAGTAATTTTGACATTTTAAGAGATGAGCTAGAAGTCATTTTGAAAG ATGTCCTTCAAGAACCCAAAACTGAAGACATAGTAGCAGTGCAGAAAGCAA

AAACCTTGTACAGATCGTGTATAAATGAGT CTGCTATTGATAGCAGAGGCGGACAACCTCTACTCAAACTGTTACCAGATATATATGGGTGGCCAGTAG

CATCAGATAACTGGGATCAAACATATG GCACTTCTTGGACAGCTGAGAAATCCATTGCACAACTGAATTCTAAATATGGGAAAAAGGTCCTCATTAATT

TTTTTGTTGGCACTGATGATAAGAATTCTACCCAGCATATAATTCAT TTTGACCAGCCTCGACTTGGCCTCCCTTCCAGAGACTACTATGAGTGCACTG

GAATATATAAAGAG GCTTGCACAGCATATGTGGATTTTATGATTTCTGTGGCCAGACTGATTCGTCAGGAACAAAGTTTGCCTATTGATGAAAACCAGC

TCTCTTTGGAAATGAATAAAGTTATGGAATTGGAAAAAGAAATTGCCAAT GCTACAACTAAACCAGAAGACCGAAATGACCCAATGCTGCTTTATAACA

AAATGACATTGGCCAAGCTGCAGAACAACTTTTCCCTGGAGGTCAATGGGAAG TCATTCAGCTGGTCAAATTTCACAAATGAAATCATGTCAACTGTGA

ATATTAATATTCAAAATGAGGAAGAAGTTGTTGTCTATGCTCCAGAATATTTAACCAAACTTAAGCCTATTCTTACCAAATATTCTCCCAG AGATCTTC

AAAATTTAATGTCCTGGAGGTTCATAATGGATCTTGTAAGCAGCCTCAGCCGAAACTACAAGGAGTCCAGAAATGCTTTCCGCAAG GCCCTTTATGGGA

CTACATCAGAAACTGCAACATGGAGACGGTGTGCTAACTACGTCAATGGGAATATGGAGAATGCTGTGGGGAGGCTTTATGTGGAAGCGGCTTTTGCTGG

AGAGAGCAAGCACGTG GTTGAAGACTTGATTGCACAAATCCGGGAAGTTTTTATTCAGACTTTGGATGACCTTACTTGGATGGATGCTGAGACAAAAAA

GAAAGCTGAAGAAAAG GCCTTGGCAATTAAAGAAAGGATTGGCTATCCTGATGACATCATTTCCAATGAGAACAAACTGAATAATGAGTATCTTGAG T

TGAACTACAGGGAAGATGAATACTTTGAGAACATAATTCAAAATTTGAAATTCAGCCAAAGCAAGCAGCTAAAGAAGCTCCGAGAAAAAGTGGACAAAGA

TGA GTGGATAAGTGGAGCAGCTGTAGTCAATGCATTTTATTCCTCAGGCCGAAATCAGATAG TCTTCCCCGCTGGCATTTTGCAGCCCCCATTCTTCA

GTGCTCAGCAATCCAACTCATTGAACTATGGGGGCATCGGCATGGTCATTGGACATGAAATCACACATGGATTTGATGACAATG GAAGAAATTTCAATA

AAGATGGAGACCTCGTTGACTGGTGGACGCAGCAGTCGGCAAATAATTTTAAAGACCAATCCCAGTGTATGGTATACCAGTATGGAAACTTTTCCTGGGA

CCTAGCAGGTGGACAGCAT CTCAATGGAATTAATACACTAGGAGAAAACATTGCTGATAATGGAGGTATTGGCCAAGCATACAGA GCCTATCAGAATT

ATGTTAAAAAGAATGGTGAAGAAAAATTACTCCCTGGACTTGACCTCAATCACAAACAACTATTTTTCCTGAACTTTGCCCAG GTGTGGTGTGGGACCT

ACCGGCCAGAGTATGCAGTCAATTCTATTAAAACAGATGTACACAGTCCTGGAAATTTCAG - UNI32797 - GATCATTGGGACTTTGCAGAACTCT

GCCGAGTTTGCAGATGCCTTTCATTGCCGCAAGAATTCATACATGAATCCAGAAAGGAAATGTCGGGTTTGGTGATCTTCACAAGATACTGAACATCCAC

GGCAAGATTTGCCAAAGCCACGGAAACAGGAACTCTTCCCTCAGAGAAACTGGGCCCCGGAAGTTTCTTCAGCTTCCTGGGGGGCAATTCACAGAGACGA

GCATGAGCTAACATAAATGAAATTAGATTATTAAATCTGCTGTGAATGAAAGGGGAGGGAGCCTACGATCTAGCAAATCAATCACTTCACTGTGTAAATA

ATGATTACTTTCCAACGGTAGTACTACCGTTCACTTCTGTTTCTCACACAGACTGCAGCTTTCATGTTGTCTGTAGAGAACAGTGTTAACACTTAAAGCA

GACTATGACTTCTGATCAAAAGGAGGACGATGCTCAGTACAGCAGGGCACCAAAGCACAGATTTGCCCCTCAGCACTCACTTTTGTTTGCAACATTCATG

CTCCTTCCAAACTCTCCCAAAGAACTCCCATACAGACTGTGGCCTTCAGGCTCGTGCAGTTTTGAACTCATTTTACCATACATAAGTTATTCATTCATCC

CACATCAATTTAGTTTGAACACTCTTAGAGCTTAAACTAGAGTATCTGAAACGGTTCCCCTATTTCACCCACTTTAGTGATGTTGAGATTCTTGAACCCC

CCTGCAGATCTTTGAGCAATTTCTTGCTCTTGCTGCCCCTCAGACTCAGTCTTTTAAAGGATTTGTAGTAATGTATAAAGAATAATTCTATATTTAATTA

TTAACTACATTTATGACTGAATAAACCATTGCTATAGGTAATCATTGAATATTGAAGTTATATGGCCAAGATAGTTTTGAAGATCTGTAACATGATATAC

AGACGAAAATTTGAGACTCTTTAAATCTGTAAATCATATTGATGAAAAGCTTTAAGTACAAACTCTGGGGGTGAGCATTACCATTGGACGGGTGTCTTGA

GATACATAATAGTTGTGGTTTACAAACAGCATTTTCAAGATTAAGTCTGTCCCTAGTGGCTAAGAAAGGGTCTAACTGTATCTGTGTTGCTCCATGAATG

CTTAGCCTTCAGGTTTGTCATCAGATGAAAATATTTTGATAATAAATTGACGTTGTGAGCCCCTTACTAGGCCTGTGTGCACGCCATGCCACCTAGCTTT

AGAAAGCCTATGTCTGAATCGAGATGGGCAGCCTCCACTGTACCTGCTTCTTGAATTCTACAGCTCATGGACTCTAATTGGATTTCCTGAGGCACTCATA

TGCCTTCCTTGTCCTTCTGCTTACTTTAGTGATTTTCACTATTCAGTATAAATTTTACAAAGATTC
Translation
 - UNI17847 - MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDD - UNI24541 - DGICKSSDCIKSA - UN

I9485 - AARLIQNMDASVEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD DVLQEPKTEDIVAVQKAKTLYRSCINES SAIDSRG

GQPLLKLLPDIYGWPVASDNWDQTYG GTSWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIH FDQPRLGLPSRDYYECTGIYKE ACTAYVDFM

ISVARLIRQEQSLPIDENQLSLEMNKVMELEKEIAN ATTKPEDRNDPMLLYNKMTLAKLQNNFSLEVNGK SFSWSNFTNEIMSTVNINIQNEEEVVVY

APEYLTKLKPILTKYSPR RDLQNLMSWRFIMDLVSSLSRNYKESRNAFRK ALYGTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHV VEDL

IAQIREVFIQTLDDLTWMDAETKKKAEEK ALAIKERIGYPDDIISNENKLNNEYLE LNYREDEYFENIIQNLKFSQSKQLKKLREKVDKDE EWISGA

AVVNAFYSSGRNQIV VFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNG GRNFNKDGDLVDWWTQQSANNFKDQSQCMVYQYGNFSWDLAG

GQH LNGINTLGENIADNGGIGQAYR AYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQ VWCGTYRPEYAVNSIKTDVHSPGNFR - UNI32797 - 

RIIGTLQNSAEFADAFHCRKNSYMNPERKCRVW
Transcript ENSMUST00000029400
Sequence
CCCACTGGTGAGTCACCGGAGAGCGAACAACCGGGCACCGGGAGCGGGGCACCAGTGTCCCCGGGGCGCCGGGAGTCG - UNI17847 - ATTTTAGG

TGATGGGAAGATCAGAAAGTCAGATGGATATAACTGATATCAATGCTCCAAAGCCAAAGAAGAAACAGCGATGGACTCCCCTGGAGATCAGCCTCTCTGT

GCTTGTCTTGCTCCTGACTATCATAGCGGTGACAATGATCGCTCTCTATGCAACCTATGATG - UNI24541 - ATGGCATTTGCAAATCATCAGACT

GCATAAAATCAG - UNI9485 - CTGCTCGACTGATTCAGAATATGGATGCCTCTGTTGAGCCATGTACAGACTTCTTCAAGTATGCTTGTGGAGGCT

GGTTGAAACGCAACGTCATTCCCGAGACCAGTTCCCGATACAGTAATTTTGACATTTTAAGAGATGAGCTAGAAGTCATTTTGAAAG ATGTCCTTCAAG

AACCCAAAACTGAAGACATAGTAGCAGTGCAGAAAGCAAAAACCTTGTACAGATCGTGTATAAATGAGT CTGCTATTGATAGCAGAGGCGGACAACCTC

TACTCAAACTGTTACCAGATATATATGGGTGGCCAGTAGCATCAGATAACTGGGATCAAACATATG GCACTTCTTGGACAGCTGAGAAATCCATTGCAC

AACTGAATTCTAAATATGGGAAAAAGGTCCTCATTAATTTTTTTGTTGGCACTGATGATAAGAATTCTACCCAGCATATAATTCAT TTTGACCAGCCTC

GACTTGGCCTCCCTTCCAGAGACTACTATGAGTGCACTGGAATATATAAAGAG GCTTGCACAGCATATGTGGATTTTATGATTTCTGTGGCCAGACTGA

TTCGTCAGGAACAAAGTTTGCCTATTGATGAAAACCAGCTCTCTTTGGAAATGAATAAAGTTATGGAATTGGAAAAAGAAATTGCCAAT GCTACAACTA

AACCAGAAGACCGAAATGACCCAATGCTGCTTTATAACAAAATGACATTGGCCAAGCTGCAGAACAACTTTTCCCTGGAGGTCAATGGGAAG TCATTCA

GCTGGTCAAATTTCACAAATGAAATCATGTCAACTGTGAATATTAATATTCAAAATGAGGAAGAAGTTGTTGTCTATGCTCCAGAATATTTAACCAAACT

TAAGCCTATTCTTACCAAATATTCTCCCAG AGATCTTCAAAATTTAATGTCCTGGAGGTTCATAATGGATCTTGTAAGCAGCCTCAGCCGAAACTACAA

GGAGTCCAGAAATGCTTTCCGCAAG GCCCTTTATGGGACTACATCAGAAACTGCAACATGGAGACGGTGTGCTAACTACGTCAATGGGAATATGGAGAA

TGCTGTGGGGAGGCTTTATGTGGAAGCGGCTTTTGCTGGAGAGAGCAAGCACGTG GTTGAAGACTTGATTGCACAAATCCGGGAAGTTTTTATTCAGAC

TTTGGATGACCTTACTTGGATGGATGCTGAGACAAAAAAGAAAGCTGAAGAAAAG GCCTTGGCAATTAAAGAAAGGATTGGCTATCCTGATGACATCAT

TTCCAATGAGAACAAACTGAATAATGAGTATCTTGAG TTGAACTACAGGGAAGATGAATACTTTGAGAACATAATTCAAAATTTGAAATTCAGCCAAAG

CAAGCAGCTAAAGAAGCTCCGAGAAAAAGTGGACAAAGATGA GTGGATAAGTGGAGCAGCTGTAGTCAATGCATTTTATTCCTCAGGCCGAAATCAGAT

AG TCTTCCCCGCTGGCATTTTGCAGCCCCCATTCTTCAGTGCTCAGCAATCCAACTCATTGAACTATGGGGGCATCGGCATGGTCATTGGACATGAAAT

CACACATGGATTTGATGACAATG GAAGAAATTTCAATAAAGATGGAGACCTCGTTGACTGGTGGACGCAGCAGTCGGCAAATAATTTTAAAGACCAATC

CCAGTGTATGGTATACCAGTATGGAAACTTTTCCTGGGACCTAGCAGGTGGACAGCAT CTCAATGGAATTAATACACTAGGAGAAAACATTGCTGATAA

TGGAGGTATTGGCCAAGCATACAGA GCCTATCAGAATTATGTTAAAAAGAATGGTGAAGAAAAATTACTCCCTGGACTTGACCTCAATCACAAACAACT

ATTTTTCCTGAACTTTGCCCAG GTGTGGTGTGGGACCTACCGGCCAGAGTATGCAGTCAATTCTATTAAAACAGATGTACACAGTCCTGGAAATTTCAG

 - UNI32797 - GATCATTGGGACTTTGCAGAACTCTGCCGAGTTTGCAGATGCCTTTCATTGCCGCAAGAATTCATACATGAATCCAGAAAGGAAAT

GTCGGGTTTGGTGATCTTCACAAGATACTGAACATCCACGGCAAGATTTGCCAAAGCCACGGAAACAGGAACTCTTCCCTCAGAGAAACTGGGCCCCGGA

AGTTTCTTCAGCTTCCTGGGGGGCAATTCACAGAGACGAGCATGAGCTAACATAAATGAAATTAGATTATTAAATCTGCTGTGAATGAAAGGGGAGGGAG

CCTACGATCTAGCAAATCAATCACTTCACTGTGTAAATAATGATTACTTTCCAACGGTAGTACTACCGTTCACTTCTGTTTCTCACACAGACTGCAGCTT

TCATGTTGTCTGTAGAGAACAGTGTTAACACTTAAAGCAGACTATGACTTCTGATCAAAAGGAGGACGATGCTCAGTACAGCAGGGCACCAAAGCACAGA

TTTGCCCCTCAGCACTCACTTTTGTTTGCAACATTCATGCTCCTTCCAAACTCTCCCAAAGAACTCCCATACAGACTGTGGCCTTCAGGCTCGTGCAGTT

TTGAACTCATTTTACCATACATAAGTTATTCATTCATCCCACATCAATTTAGTTTGAACACTCTTAGAGCTTAAACTAGAGTATCTGAAACGGTTCCCCT

ATTTCACCCACTTTAGTGATGTTGAGATTCTTGAACCCCCCTGCAGATCTTTGAGCAATTTCTTGCTCTTGCTGCCCCTCAGACTCAGTCTTTTAAAGGA

TTTGTAGTAATGTATAAAGAATAATTCTATATTTAATTATTAACTACATTTATGACTGAATAAACCATTGCTATAGGTAATCATTGAATATTGAAGTTAT

ATGGCCAAGATAGTTTTGAAGATCTGTAACATGATATACAGACGAAAATTTGAGACTCTTTAAATCTGTAAATCATATTGATGAAAAGCTTTAAGTACAA

ACTCTGGGGGTGAGCATTACCATTGGACGGGTGTCTTGAGATACATAATAGTTGTGGTTTACAAACAGCATTTTCAAGATTAAGTCTGTCCCTAGTGGCT

AAGAAAGGGTCTAACTGTATCTGTGTTGCTCCATGAATGCTTAGCCTTCAGGTTTGTCATCAGATGAAAATATTTTGATAATAAATTGACGTTGTGAGCC

CCTTACTAGGCCTGTGTGCACGCCATGCCACCTAGCTTTAGAAAGCCTATGTCTGAATCGAGATGGGCAGCCTCCACTGTACCTGCTTCTTGAATTCTAC

AGCTCATGGACTCTAATTGGATTTCCTGAGGCACTCATATGCCTTCCTTGTCCTTCTGCTTACTTTAGTGATTTTCACTATTCAGTATAAATTTTACAAA

GATTCATTTCTACAGTCCTTATTTTTATCAAAAGGTGAAAATGAAAACATTTCTATCCAAACTCTTAGTTTTCATGCCTTGTGAGAAAAGCCCACTTGCT

TGTAAAAGTGTTACAGTACAATATGTAAAATTGTATAGAACAAAAACTACAGTTCAGCGAACTGATATTCTCTGAACACAGCACCCTAGCTAAAATCTAT

AAGAAATGGAACACTGTAGCTTTCTGCCATCATCATATAACTGCTAGGCATACATTATCCAGATCTCCAGCATTATGCACTAGCTCTGCCCCATTTTGTC

TTTCAGTCATGCATTACTTCCTATCTTACTTCTCTCTGCCTTACATTTGTAAAATTTAGCTGTATGATTGGTTTATATGTGAATCTATCATTGTTGAATA

AGGTTCTGTTGTGTGACTATACTACAAATATTCCATCTTATTATTGATGGACTTTTAAGGACTCCATGAACTCCTGTCTATTCTGGTTTTGGATTGTTAC

AAATGATATAACTATGCATTATGAACTGTGCTTATATATTCACCTTTACTTGAATTATCATTGGAATCACTTTCCCAAACCTATCCAAAACTATCATAAA

TTTTAAAGACACG
Translation
 - UNI17847 - MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDD - UNI24541 - DGICKSSDCIKSA - UN

I9485 - AARLIQNMDASVEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD DVLQEPKTEDIVAVQKAKTLYRSCINES SAIDSRG

GQPLLKLLPDIYGWPVASDNWDQTYG GTSWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIH FDQPRLGLPSRDYYECTGIYKE ACTAYVDFM

ISVARLIRQEQSLPIDENQLSLEMNKVMELEKEIAN ATTKPEDRNDPMLLYNKMTLAKLQNNFSLEVNGK SFSWSNFTNEIMSTVNINIQNEEEVVVY

APEYLTKLKPILTKYSPR RDLQNLMSWRFIMDLVSSLSRNYKESRNAFRK ALYGTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHV VEDL

IAQIREVFIQTLDDLTWMDAETKKKAEEK ALAIKERIGYPDDIISNENKLNNEYLE LNYREDEYFENIIQNLKFSQSKQLKKLREKVDKDE EWISGA

AVVNAFYSSGRNQIV VFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNG GRNFNKDGDLVDWWTQQSANNFKDQSQCMVYQYGNFSWDLAG

GQH LNGINTLGENIADNGGIGQAYR AYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQ VWCGTYRPEYAVNSIKTDVHSPGNFR - UNI32797 - 

RIIGTLQNSAEFADAFHCRKNSYMNPERKCRVW

For any suggestions or comments, please send an email to unitrap@crg.es