Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027861 (Casq2)
Chromosomal location
Chr 3: 101890465 - 101950433 (+)
Description
calsequestrin 2 Gene [Source:MGI Symbol;Acc:MGI:1309469]
Human Ortholog
not available
Omim not available
UniTrap UNI35167
Vector Insertion
Chr 3: 101890796 - 101914162
Public Clones IST11193D2 (tigm) IST12522F12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37353
Vector Insertion
Chr 3: 101917089 - 101920786
Public Clones CMHD-GT_448A8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029454
Sequence
AGCAGCCTCTTTGTTCCCTCACCAACATCTCTAAGAACCTTCCATCCTGTCTTCCATGATCTCTATTCTGGAGACTGAGAAGCAAGACTTTTCCCAAATG

AAGAGGATTTACCTGCTCATGGTGGGGGTTTATCTGCTGTCCCTGAGCGGGGCAGAAGAGGGGCTGAACTTCCCCACGTACGATGGGAAAGACCGAGTGG

TCAGCCTTTCTGAGAAGAACCTCAAGCAGATGTTGAAGAGATATGATTTGCTCTGTCTCTATTACCACGAACCTGTGTCTTCAGACAAGGTCTCACAAAA

ACAGTTCCAGCTGAAGGAGATTGTACTGGAG - UNI35167 - CTTGTGGCCCAGGTCCTGGAACATAAAAACATAGGCTTTGTGATGGTGGATTCGA

GGAAAGAGGCCAAGCTTGCTAAGAGGCTGG GATTCAGTGAAGAAGGAAGCCTGTATGTTCTGAAGGGTGACCGCACGATTGAGTTTGACGGGGAGTTCG

CAGCAGATGTCTTAGTGGAATTTCTCTTGGAT CTCATTGAAGACCCAGTGGAGATCGTGAATAACAAGCTGGAGGTCCAGGCCTTTGAGCGCATCGAGG

ACCAGACCAAGCTCCTTGGCTTCTTCAAGAATGAGGACTCAGAAT ATTACAAAGCATTCCAAGAGGCAGCTGAACACTTCCAGCCTTACATCAAGTTCT

TTGCCACCTTTGACAAGGCG GTGGCAAAGAAGTTATCCTTGAAGATGAACGAAGTTGGCTTCTATGAGCCATTTATGGATGAGCCCAACGTCATCCCTA

ACAAACCGTACACAGAAGAGGAGCTTGTGGAGTTTGTGAAGGAACATCAAAG ACCCACCCTACGTCGCTTGCGCCCAGAGGACATGTTTGAAACATGG 

GAAGACGACTTGAATGGGATCCACATCGTGGCCTTTGCGGAGAAGAGTGACCCAG ATGGCTATGAGTTCCTAGAGATCCTGAAACAGGTTGCCCGGGAC

AACACTGACAATCCTGACTTGAGCATCTTGTGGATTGACCCAGATGACTTTCCACTG CTTGTTGCTTACTGGGAGAAGACTTTCAAGATTGACCTGTTC

AAGCCACAGATTGGGGTGGTGAATGTAACCGAT GCTGACAGTATCTGGATGGAGATCCCAGATGATGACGACCTGCCCACAGCTGAGGAGCTGGAAGAC

TGGATTGAAGATGTGCTTTCTGGAAAGATCAACACTGAAGATGATGACAATGAAGATGAAGATGATGATGGTGATGACAACGATGACGATGATGATGACG

ACGATGATAATGATAATTCTGATGAGGATAATGAAGACAGTGATGATGACGATGATGACGATGAATAGCTCCAGCCCTGGGTGATTCTGATGAGTGACAT

TACAACCACCATGTACCATACAGACAGCCCAAGGGGGCAGCAAGCAGTGGTGCCCACACCTAGTCAGCTCTTTTCCTTTCTCCAGCATCTTTTTCTAGTC

TGTTCTTGGCAGGAGTGGTACATTTCAGTGAATGCCTTTCCAAACCCAGCAGGCTCACACTGCAGGGACAGAAGGGGAGTGATTCCCATGCTGACTACTT

CTAACCATTGAGGAACAATCAGCCCTTGTTCTTTGCTAGACAATCAGGGGTCATGGAATTCTGGGAGTCTGGGGACTGTATCTCCTGACACCTCTACTCA

AGTTTACTTACTGTCTTTGATCCAGATGGTGACAGAACTGACAGCTTGCTATTAGTTCACAAGCAGGGAGTGGCCTTCTAATCAGAGTCCAGGAAGGGCA

CATGATTATCCAATCTCCCGCCAAACCCAGAGCATCTGTGAACTCAGACCCAAGCCTTTGGATGTCAATTAGAAATGCCTTGAAATGTGTGGGCATTGCC

ATCATTTCTGGAATATTAGGATGATGAGTGGGGGTCATCTAGCTCTATGAACATCCCATTAATTGCCAAGCCTCATATATTCACCAGTGGTAAGAGAGGC

TGAAGGATAAAAGGCTTTTCATTTTTCTGATGGAGACCGTTTAGGTCTCTGAATGGGTCTGCTGGCTGCCCAGAGTGAGCTGGGAACTGAATGCACCCTC

TCTGTCCCCGCTAGTGAGCTGTCCCATTCTGAGTTAAAATCGCTTTATCCACTGGTCAATTAACTCTCCCCATTCATCAGCACTCCCACAGTTGACCAGG

GCAGCGACCATTAAGAGTTCACGATGCCCTGAGGCACCAAGGAAAAAAAAAGAAAAGAAAAGAATCCCCAAGTGCCTTTTGAATTGTCTGAAAGTAACAG

TGTGCTTGGTAGTGTTAGTTGCTAAGTGTCCTAACTTATTTTTGAAATCTGTTAACATGGAGAAGACTCTGTGTGGTGTTGTTTTTGAAACTGGGGCAGT

CCTTTTATGGAATAGTAATAAACTAATGGACATTAGACTCATGTTTTG
Translation
MKRIYLLMVGVYLLSLSGAEEGLNFPTYDGKDRVVSLSEKNLKQMLKRYDLLCLYYHEPVSSDKVSQKQFQLKEIVLE - UNI35167 - LVAQVLEH

KNIGFVMVDSRKEAKLAKRLG GFSEEGSLYVLKGDRTIEFDGEFAADVLVEFLLD LIEDPVEIVNNKLEVQAFERIEDQTKLLGFFKNEDSEY YYKA

FQEAAEHFQPYIKFFATFDKA VAKKLSLKMNEVGFYEPFMDEPNVIPNKPYTEEELVEFVKEHQR RPTLRRLRPEDMFETW EDDLNGIHIVAFAEKS

DPD DGYEFLEILKQVARDNTDNPDLSILWIDPDDFPL LVAYWEKTFKIDLFKPQIGVVNVTD ADSIWMEIPDDDDLPTAEELEDWIEDVLSGKINTE

DDDNEDEDDDGDDNDDDDDDDDDNDNSDEDNEDSDDDDDDDE

For any suggestions or comments, please send an email to unitrap@crg.es