Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027863 (Cd2)
Chromosomal location
Chr 3: 101079831 - 101091862 (-)
Description
CD2 antigen Gene [Source:MGI Symbol;Acc:MGI:88320]
RefSeq_dna
NM_013486 
RefSeq_peptide
NP_038514.1 
UniGene
Mm.468528 Mm.22842 
MGI
MGI:88320 
Uniprot/SWISSPROT
P08920 
Uniprot/SPTREMBL
Q3UU70 Q549Q4 Q9R201 
Human Ortholog
ENSG00000116824 (CD2)
Omim not available
UniTrap UNI13551
Vector Insertion
Chr 3: 101083834 - 101086953
Public Clones CMHD-GT_300A8-3 (cmhd) IST12900D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29149
Vector Insertion
Chr 3: 101080197 - 101083710
Public Clones not available
Private Clones OST7358 (lexicon)
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098795
Sequence
GCCTCACCACAGTCCTGACAGAAAGAACTCAGAGTCACCCCTGGGAAAAGAACTCTAAAGATGAAATGTAAATTCCTGGGTAGCTTCTTTCTGCTCTTCA

GCCTTTCCGGCAAAG GGGCGGACTGCAGAGACAATGAGACCATCTGGGGTGTCTTGGGTCATGGCATCACCCTGAACATCCCCAACTTTCAAATGACTG

ATGATATTGATGAGGTGCGATGGGTAAGGAGGGGCACCCTGGTCGCAGAGTTTAAAAGGAAGAAGCCACCTTTTTTGATATCAGAAACGTATGAGGTCTT

AGCAAACGGATCCCTGAAGATAAAGAAGCCGATGATGAGAAACGACAGTGGCACCTATAATGTAATGGTGTATGGCACAAATGGGATGACTAGGCTGGAG

AAGGACCTGGACGTGAGGATTCTGG - UNI13551 - AGAAAGGTCTGTCCTTCTATGTCACAGTGGGGGTCGGTGCAGGAGGACTCCTCTTGGTGCT

CTTGGTGGCGCTTTTTATTTTCTGTATCTGCAAGAGGAGAAAACGGAACAGGAGGAGAAAAG - UNI29149 - ATGAAGAGCTGGAAATAAAAGCTT

CCAGAACAAGCACTGTGGAAAGGGGCCCCAAGCCGCACTCAACCCCAGCCGCAGCAGCGCAGAATTCAGTGGCGCTCCAAGCTCCTCCTCCACCTGGCCA

TCACCTCCAGACACCTGGCCATCGTCCCTTGCCTCCAGGCCACCGTACCCGTGAGCACCAGCAGAAGAAGAGACCTCCTCCATCAGGCACACAGATTCAC

CAGCAGAAAGGCCCTCCTTTACCCAGACCCCGAGTTCAGCCAAAACCTCCCTGTGGGAGTGGAGATGGTGTTTCACTGCCGCCCCCTAATTAAGAAGGCA

GAGTTCGTCATTTCCAATAAAAAGCTGTGTGGATTTATCTTC
Translation
MKCKFLGSFFLLFSLSGKG GADCRDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGT

YNVMVYGTNGMTRLEKDLDVRILE - UNI13551 - EKGLSFYVTVGVGAGGLLLVLLVALFIFCICKRRKRNRRRKD - UNI29149 - DEELEI

KASRTSTVERGPKPHSTPAAAAQNSVALQAPPPPGHHLQTPGHRPLPPGHRTREHQQKKRPPPSGTQIHQQKGPPLPRPRVQPKPPCGSGDGVSLPPPN
Transcript ENSMUST00000029456
Sequence
GCCTCACCACAGTCCTGACAGAAAGAACTCAGAGTCACCCCTGGGAAAAGAACTCTAAAGATGAAATGTAAATTCCTGGGTAGCTTCTTTCTGCTCTTCA

GCCTTTCCGGCAAAG GGGCGGACTGCAGAGACAATGAGACCATCTGGGGTGTCTTGGGTCATGGCATCACCCTGAACATCCCCAACTTTCAAATGACTG

ATGATATTGATGAGGTGCGATGGGTAAGGAGGGGCACCCTGGTCGCAGAGTTTAAAAGGAAGAAGCCACCTTTTTTGATATCAGAAACGTATGAGGTCTT

AGCAAACGGATCCCTGAAGATAAAGAAGCCGATGATGAGAAACGACAGTGGCACCTATAATGTAATGGTGTATGGCACAAATGGGATGACTAGGCTGGAG

AAGGACCTGGACGTGAGGATTCTGG AGAGGGTCTCAAAGCCCATGATCCACTGGGAATGCCCCAACACAACCCTGACCTGTGCGGTCTTGCAAGGGACA

GATTTTGAACTGAAGCTGTATCAAGGGGAAACACTACTCAATAGTCTCCCCCAGAAGAACATGAGTTACCAGTGGACCAACCTGAACGCACCATTCAAGT

GTGAGGCGATAAACCCGGTCAGCAAGGAGTCTAAGATGGAAGTTGTTAACTGTCCAG - UNI13551 - AGAAAGGTCTGTCCTTCTATGTCACAGTG

GGGGTCGGTGCAGGAGGACTCCTCTTGGTGCTCTTGGTGGCGCTTTTTATTTTCTGTATCTGCAAGAGGAGAAAACGGAACAGGAGGAGAAAAG - UNI

29149 - ATGAAGAGCTGGAAATAAAAGCTTCCAGAACAAGCACTGTGGAAAGGGGCCCCAAGCCGCACTCAACCCCAGCCGCAGCAGCGCAGAATTCA

GTGGCGCTCCAAGCTCCTCCTCCACCTGGCCATCACCTCCAGACACCTGGCCATCGTCCCTTGCCTCCAGGCCACCGTACCCGTGAGCACCAGCAGAAGA

AGAGACCTCCTCCATCAGGCACACAGATTCACCAGCAGAAAGGCCCTCCTTTACCCAGACCCCGAGTTCAGCCAAAACCTCCCTGTGGGAGTGGAGATGG

TGTTTCACTGCCGCCCCCTAATTAAGAAGGCAGAGTTCGTCATTTCCAATAAAAAGCTGTGTGGATTTATCTTC
Translation
MKCKFLGSFFLLFSLSGKG GADCRDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGT

YNVMVYGTNGMTRLEKDLDVRILE ERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVN

CPE - UNI13551 - EKGLSFYVTVGVGAGGLLLVLLVALFIFCICKRRKRNRRRKD - UNI29149 - DEELEIKASRTSTVERGPKPHSTPAAA

AQNSVALQAPPPPGHHLQTPGHRPLPPGHRTREHQQKKRPPPSGTQIHQQKGPPLPRPRVQPKPPCGSGDGVSLPPPN

For any suggestions or comments, please send an email to unitrap@crg.es