Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027864 (Ptgfrn)
Chromosomal location
Chr 3: 100844159 - 100914089 (-)
Description
prostaglandin F2 receptor negative regulator Gene [Source:MGI (curated);Acc:Ptgfrn-001]
RefSeq_dna
NM_011197 
RefSeq_peptide
NP_035327.2 
UniGene
Mm.24807 
MGI
MGI:1277114 
Uniprot/SWISSPROT
Q9WV91 
Uniprot/SPTREMBL
O54696 Q5SRA8 Q69ZJ6 
Human Ortholog
ENSG00000134247 (PTGFRN)
Omim not available
UniTrap UNI14566
Vector Insertion
Chr 3: 100884050 - 100914090
Public Clones (sanger) D187C12 (ggtc) FHCRC-GT-S6-10F1 (fhcrc) IST11621G7 (tigm)
IST10921E10 (tigm) IST14989D10 (tigm) IST11308B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16471
Vector Insertion
Chr 3: 100854121 - 100860158
Public Clones not available
Private Clones OST460261 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102694
Sequence
CGGAGAGTCGCTCCCGCCGGCCGAGCATGGGGCGCCCGGCGCCGAGGCCGCTGCTGCTGGCGCTCCTGTCGCTGG - UNI14566 - CTGTCTGCCGT

GGGCGTGTGGTGAGAGTCCCTGCGGGCACCCTGGTTCGCGTGGTGGGCACTGAGCTGGTGATCCCCTGCAATGTCAGCGACTATGACGGCCCCAGCGAGC

AGAACTTCGACTGGAGCTTCTCGTCTTCCGGGAGCAGTTTCGTGGAGCTTGCTAGCACCTGGGAGGTGGGCTTCCCGGCACAGCTGTACCGGGAGCGGCT

GCAGCGGGGTGATATCCTGTTGAGGAGAACTGCCAACGATGCTGTGGAACTGCACATAAAGAATGTCCAGCCCTCAGACCAAGGCCACTACAAGTGTTCC

ACCCCGAGCACGGATGCCACTGTCCAGGGCAACTACGAGGACACAGTGCAGGTTAAAG - UNI14566 - TGCTGGCAGATGCCCTGGTGGTGGGTCC

CAGCTCCCGGCCTCCTCCAGGCCTGAGCCTGCGTGAGGGGGAGCCCTTTGAGCTGCGATGTATCGCGTCTACCACGTCACCGTTGCACACACACCTGGCA

CTTCGGTGGGAACTGCACCGTGGCCCGGTGCACCGAAGCATCCTAGCCCTAAGCCACGAGGGCAGGTTTCACCCAGGCCCTGGCTATGAGCAGCGCTACC

ACAGTGGGGACGTACGCCTGGACACAGTAGGCAGCGATGCCTACCGCCTCTCCGTAGCCCGGGCGCTCTCTGCGGACCAGGGTTCCTATAGATGTGTGGT

CAGCGAGTGGATCACAGAGCAGGGCAGCTGGCAAGAAATCCAAGAAAAAGCCGTGGAAGTGGCCACTGTGGTGATCCAGCCGACAG CTCTGCAACTGGC

CGTGCCCAGGACAGTGTCTGTGACTGAAGGAAAGGACCTGGATCTTTCTTGCAACATCACAACAGACCGTGTGGATGATGTCCGGCCTGAGGTGACATGG

TACTTCAAAAAGACACCCGATACCTCTTTACTTGCCTCCCACATGCTGGCGCGGCTTGACCGTGATTCCCTGGTCCACAGCTCACCACACGTTGCTCTCA

GTCACGTGGATACCCGCTCTTACCATCTACTGGTGCGAGATGTTAGCAAAGAAAACTCGGGCTACTATCTTTGCCTTGTGGCCCTCTGGGCTCCTGGACA

CAACAGGAGCTGGCACAAGGTGGCAGAGGCCATGTCTGCCCCGTCTGGTGTAAGCGTGACCTGGCTAG AACCAGAATACCAGGTCTACCTGAACGCTTC

TAAGGTCCCCGGGTTTTCAGACGACCCCACGGAACTGCAGTGCCGGGTGATAGACACGAAGCGTCTGGAGGCCGGTGTCCGACTTACCGTGTCGTGGTAC

TATAGAATGACCCGTCGCAATGACGACGTGGTGGCCAGTGAGCTTCTCGCAGTCATGGATGGGGACTGGACTCTGAGATATGGAGAGAGGAGCAAGCAGC

GGGCCCAGGACGGAGAGTTTATTTTTTCTAAGGAGCACACAGACACATTCAATTTCCGGATCCAAAGGACTACGGAGGAAGACAGGGGCAATTATTACTG

TGTTGTGTCTGCCTGGACCAGGCAGAGGAACAACAGCTGGGTGAAGAGCAAAGATGTCTTCTCCAAGCCTGTCAACATATTCTGGGCCTCAGAAG ATTC

TGTGCTCGTGGTGAAGGCACGGCAGCCAAAGCCTTTCTTTGCTGCAGGGAATACATTTGAGATGACTTGCAAAGTGTCTTCCAAGAATATTAAGTCGCCA

CGATACTCAGTTCTCATCACGGCTGAGAAGCCCGTCGGGGACCTCTCCAGTCCCAACGAGACCAAGTACATTATCTCCCTGGACCAGGACTCCGTGGTGA

AGCTGGAGAACTGGACCGACGCGTCTCGGGTGGATGGCGTGGTGTTGGAGAAAGTTCAGGAGGATGAGTTCCGATACCGAATGTACCAGACTCAGGTCTC

CGATGCGGGCCTGTACCGCTGCATGGTGACAGCCTGGTCTCCTATTGGGGGCAGCTTGTGGCGAGAGGCAGCGACCAGTCTCTCCAATCCTATTGAGATC

GACTTCCAAACCTCAG - UNI16471 - GTCCCACATTTAACGCCTCTGTGCATTCAGACACACCATCCGTCACCCGGGGAGATCTCATCAAATTGTT

CTGTATCGTCACTGTGGAAGGAGCTGTGCTGGACCCAG ATGACATGGCCTTCGATGTATCCTGGTTTGCGGTACACTCTTTTGGCTTGGACAAGGCTCC

CGTCCTCCTCTCCTCCTTGGACCGGAAGGGAGTCGTGACGACAGGCCAGAGGGACTGGAAGAGTACTGTCAGCCTGGAGCGAGTGAGCGTGCTGGAATTC

TTGCTGCAAGTGCATGGCTCTGAGGACCAGGACTTTGGCAACTACTACTGTTCTGTGACTCCCTGGGTGAGGTCACCGACAGGTTCCTGGCAGAGGGAAG

CCGAGATCCACTCCAGGCCCATCTTTATAACTGTGAAGATGGACG TGCTGAACGCCTTCAAGTACCCGCTGCTGATCGGCGTGGGCCTGTCCACAGTCA

TCGGGCTCCTGTCCTGCCTCATCGGATACTGCAGTTCCCATTGGTGCTGTAAGAAGGAGGTTCGGGAGACGCGTCGGGAGCGCCGCAGGCTCATGTCCAT

GGAGATGGATTAAGCAGTTGGAGATGGAGGGACAGAGGAACATTGTAGGAGCGGTGGGGGTGAGAAGAGGACTCTGATATTTTTACAACCGAGTGTGTTA

CACTAAAACCAGTCCTCTCTAATCTCAGGTGGGACTCGGCGCTCTCTCTTTTCTGCATGTCAAGTTCTGAGCGAGGACATGTTTACCAGCACACAGCTCT

TCTTCCCACGGCACTTTCTGATATGTAACAATCGAGTGTGTGTTTCCCCCAGCTGCAGCTTTTTAATGGTTAACCCCCCACCCCACCCCCCACCCCCGTC

TAATTAGTTTTCTCCTAGCGGCTTATCGATCCTCTGATTTGTGTGTGTTGCTCACTTTTGATTTAGGGATCTCGGTGAGGTAGGGCGAAGGCATTCAGAG

TTGGTCATTGTGGGTAAGAGGGTACCGGCCCACCCGAAAGCCAGCATCCACGAGCAGCCAGCATCGGGAGAGCTGCTACCTGCTGCCCTCCACCCTGGCT

CAGAGCTGATATAGACCTGTGCCAAGGCAAGCTGTGGCTTTGACTGCCCTGCCCATCCCCCATTGTCAGGGGTTTAAAACTCTATAACTTCTTGGCCCGT

AAGCCTTTTGTTTCCCCTCCTTCTCTACCCTCTTCCGTTTTCCGGGTTTGTTTCTGTGAGTGAGGATACGGCAGCCCTGGAGTCTAGAATTCGGCTTTCC

ACCAAGCACCTTATCTCGCCACCTTAGCCTTAAGAATGAGTATGAAAAAAATCCAGCACCACCTCTGTCCAGGGCAGAAGGTCTGGGAGGAGGAGGAGGA

GGAGGACACGGGGGGGGGGGGGGGGGGGAGGAGGGGGGCGGGGGGGGGGGAGGAACTGATGCTCGCCCACCCACGTGCTCGCTCTGGTAGTTCTTAGGCC

ACTGTGCTCCAGGAACCCCAGGGTGAGTGGGAGCAGAGGGCAGCCGTGCCGCCGAGCCAGGTGCCCTGTCCCTTCATGAGAGGCACTGTCCCTGGTGCCA

CAGGACCGCCATGGGAGCCACAAAAGTGCCACATTGAGCTTCTTCACAGGAAGGCAGGTTGCTGCCTGCAAGACTGACGGACTTCAAGGAATCAGAAATT

GCCTAGAGCAAGCGTGTGTTCTCCATGACCTTTTCAGTCCTTGAAGTCTTTCTAAGCTCCCCGCAGGGGGTAGTGAAGAGGGGTATACTTTGTGAACGTT

TGCTTTCCTATTAGAAACATGAAGGGAACCCAGCTATTTAGTGTTATGTGAATGGCCTGTAAAATAGGGTTGAGAGCAGCTGCCTCTGCCTGGCTGGGCC

CAGCAGGAACGGGACAGCGGGCAGGCACATCTTCCAGGTCACCAGTGCCTGCTCCATCAGGGCCTCAGCCACACAGATTCTCTCACCTCAGCATAGCCTT

CCTGAGCCTCCCCTGAGTACTGAGGCTCACCACCCAGCTGGTACCCTCGCCCTGCCTTCTGCCTCTGAAGGATTTAACATTGTTGTCTTCCAAGGGGGGA

CGGGGAGAAGAGTCCTTTCTCTTAAGCAATAAAGTAATCCGAAAACATGGCCATCACGTGCAGCTCTAGTCAACACGGACCAGGATGCGCTGAGCCCCCA

CCCCCACCCCCGCCTTCTCTCCATGTGGCCCACGGTGGCTTTTGTATTTTCCACCCAATTTCCTCTGCTTGTTTTGAGCCCACCTTGGGGGCTGCTCGTG

TAATGAGATTTTGAGAAGGTAGCTCTAGCCCAGGTGGGGTCCAGGTTTAGAGTCAGTAGCAGATGCACCCCACACAAGCAAGAGAGGCCAGAGAAAGGGG

AGGCTTGGCAGACACGGTTGGTCTACATGTCGCTTTCTTGTTGCTAGCTCAGACGTGAGGCACAGGTGACTGTACAAACAGGAATTAGGGGAGAGAACCA

GGTGTTAGGAGCAGCCTTCGAGCCTGTGCCATTACTGAAGAAGATTCAGGGTCTTGGCAGTACAGCCCTCCTTAGGAGGATGAGAGAGACTTAGCCTGGG

GTGAGATGAGCCCTAGATGTACATAAAGCCACAGTGGTCCACGTGGGTACTGGATGATGAGATGAGTGATCGGACCTACCTTTCCCTTTCGTCTGATGTT

GAGATTTGAACCTGAGTTGTGGAGGCCATGCCCAAACCCCCATGTTGCTTAGGGTTGGGAGAGGGGCCAGAAACCTCAGGACCTAGTTCCTTTTGGGAAT

CTTACCATGCTGGGGTGTGTGTCTTGTTAAGTGTGGTCAAACACTCTTGATGTACCAAATAGTGCTCCCCATGAAGCGCTCTTCCTGAGGCCCCCACCCT

GCAACACTGCTCTGGGGGAGGGAGAGGCCGAGCCAGGCCTTGGCACATGAAATTGCACTTCTTAAAGAGAAAACTTTATAGAAGGTTGGGTATTTTTCCT

AATCACAAAAATCTCCCGCTGAAAGAACCTAAGCTACATTCAGATTGAAGCCTCGAAAATTACTTTAAATTGTTTACTTTACGATGTTTACACACACGGC

TCACTTTTTTAGAAAAATAAGAAAACTGCAAACTCTGGCTTTTTAACAACTTTTCAGATTTTTTCATGCATGGGATATGCTGGCCCCTGACTCACCAGCT

GGATTAATCCTCATTTAGAAATGTCCCGAGATGTGGATATGTGTGTCTTCCCCCTCCCAGCCACATGCCCAGACCTCTGTCTGTTTCTCTGGTGGCTTTT

GCCTCCTGCTTTGCAGACCGCCTGCAGCCATGATTTTGTTACGGCATCCATGAGCCAAAGACTGCGCTTCGGAGCAGGAACTGTAAGCAATACTACACAA

CTTGCTACTTTTGGGGGGAATTTTTTTTTTAACTTCACTCATGACAACAGAGGAAGAAAGGAATTGAGGTTTAGGTAAGTTCTCTTCCACTGTGTGACCA

GATTCTCGGTGACACACAATTGTGCAGATCACTAGGAGAAGGAGGTTGGGTTTCTTTTCTAGTGTGTAACACGAGGATCTGCAGAATTTCCCATAGACAA

AGAGAAGGTCTTGTGTATTTTTGTCCCTATCCAAGGTTATACAAACTAATTGTGTTGTTTTATACTGTGCCCACAAATATTATGCAATGCACCATTTGTT

TTTGTCTTTATTTTATTAAAGGAAGTTTAATTT
Translation
MGRPAPRPLLLALLSLA - UNI14566 - AVCRGRVVRVPAGTLVRVVGTELVIPCNVSDYDGPSEQNFDWSFSSSGSSFVELASTWEVGFPAQLYRE

RLQRGDILLRRTANDAVELHIKNVQPSDQGHYKCSTPSTDATVQGNYEDTVQVKV - UNI14566 - VLADALVVGPSSRPPPGLSLREGEPFELRCI

ASTTSPLHTHLALRWELHRGPVHRSILALSHEGRFHPGPGYEQRYHSGDVRLDTVGSDAYRLSVARALSADQGSYRCVVSEWITEQGSWQEIQEKAVEVA

TVVIQPTA ALQLAVPRTVSVTEGKDLDLSCNITTDRVDDVRPEVTWYFKKTPDTSLLASHMLARLDRDSLVHSSPHVALSHVDTRSYHLLVRDVSKENS

GYYLCLVALWAPGHNRSWHKVAEAMSAPSGVSVTWLE EPEYQVYLNASKVPGFSDDPTELQCRVIDTKRLEAGVRLTVSWYYRMTRRNDDVVASELLAV

MDGDWTLRYGERSKQRAQDGEFIFSKEHTDTFNFRIQRTTEEDRGNYYCVVSAWTRQRNNSWVKSKDVFSKPVNIFWASED DSVLVVKARQPKPFFAAG

NTFEMTCKVSSKNIKSPRYSVLITAEKPVGDLSSPNETKYIISLDQDSVVKLENWTDASRVDGVVLEKVQEDEFRYRMYQTQVSDAGLYRCMVTAWSPIG

GSLWREAATSLSNPIEIDFQTSG - UNI16471 - GPTFNASVHSDTPSVTRGDLIKLFCIVTVEGAVLDPD DDMAFDVSWFAVHSFGLDKAPVLLS

SLDRKGVVTTGQRDWKSTVSLERVSVLEFLLQVHGSEDQDFGNYYCSVTPWVRSPTGSWQREAEIHSRPIFITVKMDV VLNAFKYPLLIGVGLSTVIGL

LSCLIGYCSSHWCCKKEVRETRRERRRLMSMEMD

For any suggestions or comments, please send an email to unitrap@crg.es