Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027865 (Gdap2)
Chromosomal location
Chr 3: 99966388 - 100010575 (+)
Description
ganglioside-induced differentiation-associated-protein 2 Gene [Source:MGI (curated);Acc:Gdap2-001]
RefSeq_dna
NM_010269 
RefSeq_peptide
NP_034399.1 
UniGene
Mm.475901 
MGI
MGI:1338001 
Uniprot/SWISSPROT
Q9DBL2 
Human Ortholog
ENSG00000196505 (GDAP2)
Omim not available
UniTrap UNI34835
Vector Insertion
Chr 3: 99991957 - 99994808
Public Clones IST13334A9 (tigm) IST14477D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7649
Vector Insertion
Chr 3: 100006394 - 100009694
Public Clones RRR721 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106997
Sequence
GCTGTCGCCAGTCACCCTGGCCTCTGGAGACCGGTTCGCTTCAGCCTCCGCCTCTGGCAAGCAAAGTGTACGGATGTCATCCGCCTGAATTCTGCCACGG

ATCTGAGTGAGCTGCGGGCCGCCGCCCGGATGGGCCCGCCCGAGCGCT CTCAAATCTCCAGGGATTGTTGAATTGCCAAAGAGTTTGGTTCACGAGCTG

AAGCTCCCATTCCATGGATCCCTTGGGTGCACCTTCCCAGTTTGTGGATGTGGATACCCTGCTAAGCTGGGGCGACTCGTACGAAGATGAAGTAGACTGC

GCTGACAGTACTGCCGAGGCCTTCCAGGAAGACGCCAGCAGATCACCTTTTGTTTATAGTCGGGACGTCAATGGAAAAGTGGTTCTTTG GAAAGGAGAT

GTGGCATTACTGAACTGCACAGCCATTGTGAATACCAGCAATGAAAGCCTCACAGATAAGAACCCTGTGTCAGAGAGCATCTTCATGCTTGCGGGGCCAG

ATTTGAAGGAGGACCTTCAGAAACTCAAAG GTTGCCGAACTGGTGAAGCAAAATTGACGAAAGGCTTTAACCTAGCTGCTCGGTTCATCATTCACACAG

TGGGACCTAAGTACAAGAGCCGCTACCGCACTGCAGCGGAGAGTTCCCTGTACAGCTGTTACAGAAACGTGCTTCAGCTGGCAAA AGAACAGTCCATGT

CTTCTGTTGGCTTCTGTGTCATCAATTCTGCCAAGCGAGGTTATCCACTAGAAGATGCAACACACATCGCTCTTC GTACTGTGAGGCGGTTCCTAGAGA

TCCATGGGGAAAACATTGAAAAAGTAGTATTTGCTGTCTCAGAACTCGAAGAG GCCACTTACCAAAAGCTGCTACCTCTGTACTTCCCAAGGTCATTAA

AGGAGGAGATCCGGTCATTGCCGTACCTACCTGCAGACATTGGAAATGCAGAAGGGGAGCCCGTGGTGCCCGAGCGGCAAATTAGAATCAGTGAGAAACC

CGGTGCCTCGGAGG ACAATGAAGAGGAAGATGAGGATGAAGGCTTGGGAGTGGATCTGTCTTTTATTGGCTCTCATGCTTTTGCTCGGATGGAAGGAGA

TATTGACAAGCAAAGAAAGTTGATCCTCCAGGGACAGTTGTCTGAAGCCGCCCTGCAGAAGCAGCATCAAAGAAA - UNI34835 - TTATAATCGCT

GGTTATGCCAAGCAAGATCTGAAGACCTGTCTGATATTGCTTCTCTGAAAGCTTTATACCAAACAG GGGTAGATAACTGTGGCCGCACAGTGATGGTGG

TAGTTGGAAGAAACATTCCTGTGACACTGATAGATATGGACAAG GCCCTCTTGTATTTTATCCATGTAATGGATCACATTGCTGTGAAGGAGTATGTGC

TGGTGTATTTCCACACACTGACCAGCGACTACAATCACCTGGACTCCGACTTCCTGAAGAAACTCTACGATGTGGTTGACATCAA ATACAAGAGGAATT

TGAAGGCTGTTTATTTCGTTCATCCAACATTCCGTTCAAAG GTCTCAACATGGTTTTTCACCACCTTTTCTGTCTCAGGACTGAAGGACAAGATCCACC

ACGTAGACAGCCTGCAGCAGCTCTTCTCTGCCATATCACCAGAGCAGATAGACTTTCCTCCTTTTGTCCTTGAATATGACGCGAGGGTAAGTGCCTGTCC

TCCTTTGCCTGGTGTAGTATGCAGGTGTGCCGCAGCAGCAGGTGTGAGCATATGGGTGTGTCACGGAGCGGCAGGTGTGAGCTTGTGTGTTTCATGCTAC

ATGCCTACCATGAAGGCTGCTTCACAGAGCTTTTGTCTCATTACATGCAGATACACTCCCGTGTGTTCAGTATGCTGAGACAGCGTATGTGTCACACAAC

AGTCCCTGTGAGCATCTGTCTGTAAGCGTGCTGCAGAGCAACAGCCATGAGCTTTGGGATAATCATTTAGCATGTTCACCCAATAACCTTAGGAAACATC

CTTGTCCCAGGAGGGTTTTCCCAAAATCAACACTTTAGC
Translation
 MDPLGAPSQFVDVDTLLSWGDSYEDEVDCADSTAEAFQEDASRSPFVYSRDVNGKVVLW WKGDVALLNCTAIVNTSNESLTDKNPVSESIFMLAGPDL

KEDLQKLKG GCRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLAK KEQSMSSVGFCVINSAKRGYPLEDATHIALR RTVRR

FLEIHGENIEKVVFAVSELEE ATYQKLLPLYFPRSLKEEIRSLPYLPADIGNAEGEPVVPERQIRISEKPGASED DNEEEDEDEGLGVDLSFIGSHAF

ARMEGDIDKQRKLILQGQLSEAALQKQHQRN - UNI34835 - NYNRWLCQARSEDLSDIASLKALYQTG GVDNCGRTVMVVVGRNIPVTLIDMDK 

ALLYFIHVMDHIAVKEYVLVYFHTLTSDYNHLDSDFLKKLYDVVDIK KYKRNLKAVYFVHPTFRSK VSTWFFTTFSVSGLKDKIHHVDSLQQLFSAIS

PEQIDFPPFVLEYDARVSACPPLPGVVCRCAAAAGVSIWVCHGAAGVSLCVSCYMPTMKAASQSFCLITCRYTPVCSVC
Transcript ENSMUST00000029459
Sequence
GCTGTGATTGGGTGGCGTGGCGGAGAGGAAGCGGGTACCTTCGCTGTCAGATCGCTGTCGCCAGTCACCCTGGCCTCTGGAGACCGGTTCGCTTCAGCCT

CCGCCTCTGGCAAGCAAAGTGTACGGATGTCATCCGCCTGAATTCTGCCACGGATCTGAGTGAGCTGCGGGCCGCCGCCCGGATGGGCCCGCCCGAGCGC

T CTCAAATCTCCAGGGATTGTTGAATTGCCAAAGAGTTTGGTTCACGAGCTGAAGCTCCCATTCCATGGATCCCTTGGGTGCACCTTCCCAGTTTGTGG

ATGTGGATACCCTGCTAAGCTGGGGCGACTCGTACGAAGATGAAGTAGACTGCGCTGACAGTACTGCCGAGGCCTTCCAGGAAGACGCCAGCAGATCACC

TTTTGTTTATAGTCGGGACGTCAATGGAAAAGTGGTTCTTTG GAAAGGAGATGTGGCATTACTGAACTGCACAGCCATTGTGAATACCAGCAATGAAAG

CCTCACAGATAAGAACCCTGTGTCAGAGAGCATCTTCATGCTTGCGGGGCCAGATTTGAAGGAGGACCTTCAGAAACTCAAAG GTTGCCGAACTGGTGA

AGCAAAATTGACGAAAGGCTTTAACCTAGCTGCTCGGTTCATCATTCACACAGTGGGACCTAAGTACAAGAGCCGCTACCGCACTGCAGCGGAGAGTTCC

CTGTACAGCTGTTACAGAAACGTGCTTCAGCTGGCAAA AGAACAGTCCATGTCTTCTGTTGGCTTCTGTGTCATCAATTCTGCCAAGCGAGGTTATCCA

CTAGAAGATGCAACACACATCGCTCTTC GTACTGTGAGGCGGTTCCTAGAGATCCATGGGGAAAACATTGAAAAAGTAGTATTTGCTGTCTCAGAACTC

GAAGAG GCCACTTACCAAAAGCTGCTACCTCTGTACTTCCCAAGGTCATTAAAGGAGGAGATCCGGTCATTGCCGTACCTACCTGCAGACATTGGAAAT

GCAGAAGGGGAGCCCGTGGTGCCCGAGCGGCAAATTAGAATCAGTGAGAAACCCGGTGCCTCGGAGG ACAATGAAGAGGAAGATGAGGATGAAGGCTTG

GGAGTGGATCTGTCTTTTATTGGCTCTCATGCTTTTGCTCGGATGGAAGGAGATATTGACAAGCAAAGAAAGTTGATCCTCCAGGGACAGTTGTCTGAAG

CCGCCCTGCAGAAGCAGCATCAAAGAAA - UNI34835 - TTATAATCGCTGGTTATGCCAAGCAAGATCTGAAGACCTGTCTGATATTGCTTCTCTG

AAAGCTTTATACCAAACAG GGGTAGATAACTGTGGCCGCACAGTGATGGTGGTAGTTGGAAGAAACATTCCTGTGACACTGATAGATATGGACAAG GC

CCTCTTGTATTTTATCCATGTAATGGATCACATTGCTGTGAAGGAGTATGTGCTGGTGTATTTCCACACACTGACCAGCGACTACAATCACCTGGACTCC

GACTTCCTGAAGAAACTCTACGATGTGGTTGACATCAA ATACAAGAGGAATTTGAAGGCTGTTTATTTCGTTCATCCAACATTCCGTTCAAAG GTCTC

AACATGGTTTTTCACCACCTTTTCTGTCTCAGGACTGAAGGACAAGATCCACCACGTAGACAGCCTGCAGCAGCTCTTCTCTGCCATATCACCAGAGCAG

ATAGACTTTCCTCCTTTTGTCCTTGAATATGACGCGAGG - UNI7649 - GAAAATGGGCCTTATTTTGCATCTTATCCTCCATCACCAGATTTGTGA

CCTGCGCCTTCCCAGTGCTTCTCGGTCACAGGATTCCATTTAACCACAACTCGCCACCTATCGGAGTGATGTTCATTTTTGCTGTACAGATCCAGAGAGC

TTTTGTCCCCACCTCTCTGGTATTTTTTTATTGACTATATATTTTCTGGCACATAAACAATCTAAAACTGGTAGGCCATTCTGAACTGCATACATTTTAA

ATTTGTATATTTGTATCAAATGGAAATGCTCATTTTTAGAGCATTAATAGAAACTGGGGATCAACTTTTGAGTGTCTCCAGTTTCCTAAAGGACACTGGA

CTCTGTCACACAGGCCACCAACGTTGCTCACATCATCTCTTACAGTGCACGCTTCCGGACTCTGTTACATAGGCCGCCACCATTGTTCATAGCATCTCTT

AAACAGTGCACGCTCTCTCTGTGTATTTAAGTGTTTCTCAAAATATATAGAACCAATGTATGCTAAACGGATGCATTGTTCCCTCAGATCCTGGCTTTAA

TACCATTTACATTTTATACAGACGATCTGATTATAATATAGAATTGCCCATGACCAAGAATATTGAAATGTGTATGATCAAAACTGTAAAAACCTTCAAC

AACATAGAATTGGCAGATTGTTGGCCCAAGCTACAGCTGAGCTGTGCGTGCTTCTTGGGTTGTCTACTTTGTTCCTATTGACACTGCTCTGATCTCAGTG

TGGAGAGCATGAGACTGTACCTTCAACTGTCTTCTTTAATCATGTGACTCGTGACTCGTCTCTTTACCAAAAGAATGTTTGTGCTCCCAGCACTCCTAAG

TAAAGACCATTTCCCAGGACTCCATCCCTGACC
Translation
 MDPLGAPSQFVDVDTLLSWGDSYEDEVDCADSTAEAFQEDASRSPFVYSRDVNGKVVLW WKGDVALLNCTAIVNTSNESLTDKNPVSESIFMLAGPDL

KEDLQKLKG GCRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLAK KEQSMSSVGFCVINSAKRGYPLEDATHIALR RTVRR

FLEIHGENIEKVVFAVSELEE ATYQKLLPLYFPRSLKEEIRSLPYLPADIGNAEGEPVVPERQIRISEKPGASED DNEEEDEDEGLGVDLSFIGSHAF

ARMEGDIDKQRKLILQGQLSEAALQKQHQRN - UNI34835 - NYNRWLCQARSEDLSDIASLKALYQTG GVDNCGRTVMVVVGRNIPVTLIDMDK 

ALLYFIHVMDHIAVKEYVLVYFHTLTSDYNHLDSDFLKKLYDVVDIK KYKRNLKAVYFVHPTFRSK VSTWFFTTFSVSGLKDKIHHVDSLQQLFSAIS

PEQIDFPPFVLEYDAR - UNI7649 - ENGPYFASYPPSPDL

For any suggestions or comments, please send an email to unitrap@crg.es