Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027878 (Notch2)
Chromosomal location
Chr 3: 97851650 - 97951367 (+)
Description
Notch gene homolog 2 (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:97364]
RefSeq_peptide
NP_035058.2 
UniGene
Mm.254017 
MGI
MGI:97364 
Uniprot/SWISSPROT
O35516 
Uniprot/SPTREMBL
Q6PCM9 Q3U1W7 
Human Ortholog
ENSG00000134250 (NOTCH2)
Omim 610205 - ALAGILLE SYNDROME 2  
UniTrap UNI9479
Vector Insertion
Chr 3: 97851733 - 97874782
Public Clones RST488 (baygenomics) (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9822
Vector Insertion
Chr 3: 97885963 - 97902018
Public Clones XST194 (baygenomics) KST222 (baygenomics) E324A03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10229
Vector Insertion
Chr 3: 97911081 - 97915472
Public Clones PST069 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8342
Vector Insertion
Chr 3: 97915666 - 97916932
Public Clones STA005 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10527
Vector Insertion
Chr 3: 97924879 - 97925826
Public Clones G058F11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10227
Vector Insertion
Chr 3: 97935358 - 97938481
Public Clones PST065 (baygenomics) LST103 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2283
Vector Insertion
Chr 3: 97943606 - 97945386
Public Clones AG0498 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107028
Sequence
GCTTTGCAGTGTCGAGGTGGTCAAGAGCCCTGTGTAAATGAAGGGACCTGTGTTACCTACCACAACGGCACAGGCTTCTGCCG - UNI9479 - ATGT

CCAGAGGGCTTCTTGGGAGAATATTGCCAACATCGAGACCCCTGTGAGAAAAACCGCTGTCAGAATGGTGGTACTTGTGTGCCGCAGGGCATGTTGGGGA

AAGCTACCTGCCGATGTGCTCCAGGATTCACAGGAGAGGACTGCCAATACTCCACCTCTCACCCCTGCTTTGTGTCCCGCCCTTGTCAGAATGGGGGTAC

CTGTCACATGCTCAGCCGGGACACCTACGAGTGCACCTGCCAAGTCGGCTTCACAG GGAAGCAGTGTCAGTGGACAGATGCCTGTCTATCTCATCCCTG

CGAAAATGGAAGCACCTGTACATCTGTGGCCAGCCAGTTCTCCTGCAAATGCCCTGCAGGCCTCACAGGGCAGAAGTGTGAAGCTGATATCAATGAGTGT

GACATTCCAGGACGCTGCCAACATGGTGGCACCTGCCTCAACCTTCCTGGTTCCTACAGATGCCAATGTCCTCAGGGCTTCACAGGCCAGCACTGTGACA

GCCCTTATGTGCCCTGTGCACCCTCGCCCTGCGTCAACGGAGGCACCTGTCGTCAGACTGGCGACTTCACTTTCGAATGCAACTGCCTGCCAG GTTTTG

AAGGGAGCACCTGTGAGCGGAATATCGACGACTGCCCCAACCACAAGTGTCAGAATGGAGGAGTTTGTGTGGATGGTGTCAATACCTACAATTGCCGCTG

TCCCCCTCAGTGGACTG - UNI9822 - GGCAGTTCTGCACAGAAGATGTGGACGAGTGTCTGTTGCAGCCCAACGCTTGTCAGAATGGAGGCACCTG

CACCAACCGAAACGGAGGCTATGGCTGCGTGTGTGTGAACGGCTGGAGCGGAGATGACTGCAGCGAGAATATCGATGACTGTGCCTATGCTTCCTGCACG

CCAGGGTCCACCTGCATTGACCGCGTGGCCTCCTTCTCCTGCCTGTGTCCGGAGGGAAAGGCGG GTCTCCTGTGCCATCTGGATGATGCCTGTATCAGC

AACCCTTGTCACAAGGGGGCGCTGTGTGACACCAACCCCCTGAACGGGCAGTACATTTGCACCTGCCCACAGGGCTACAAGGGCGCTGACTGCACAGAAG

ACGTGGATGAGTGTGCTATGG CCAACAGTAACCCTTGTGAGCATGCAGGAAAGTGTGTGAATACAGATGGCGCCTTCCACTGTGAGTGTCTGAAGGGCT

ACGCAGGGCCTCGCTGTGAGATGGACATCAACGAGTGTCATTCAGACCCCTGCCAGAACGACGCCACCTGCCTGGATAAGATCGGAGGCTTCACCTGTCT

GTGCATGCCAG GTTTCAAAGGTGTGCATTGTGAGCTGGAGGTAAATGAATGCCAGAGCAACCCGTGTGTGAACAACGGGCAGTGTGTGGACAAAGTCAA

CCGCTTCCAGTGTCTGTGTCCCCCTG GCTTCACAGGACCAGTGTGCCAGATCGACATTGATGACTGCTCCAGTACTCCCTGCCTGAATGGGGCCAAGTG

CATCGATCACCCGAATGGCTATGAATGCCAGTGTGCCACAG GTTTCACTGGCATATTGTGTGATGAGAACATCGACAACTGTGACCCAGATCCTTGCCA

CCATGGCCAGTGCCAGGATGGGATCGACTCCTACACCTGCATCTGCAACCCTGGGTACATGGGAGCCATCTGTAGTGACCAGATTGATGAATGCTACAGC

AGCCCTTGCTTGAACGATGGGCGCTGCATTGACCTGGTGAATGGTTACCAGTGCAACTGCCAACCAGGCACATCAG GCCTTAATTGTGAAATTAATTTT

GATGACTGTGCCAGCAACCCTTGTATGCACGGAGTCTGTGTGGACGGCATCAATCGCTACAGCTGTGTGTGCTCTCCGGGATTCACAG - UNI10229 

- GCCAGAGGTGCAATATTGACATTGATGAGTGTGCCTCCAACCCCTGTCGCAAGGGTGCGACGTGCATCAATGATGTGAATGGTTTCCGGTGTATATGC

CCCGAGGGACCGCATCATCCTAGCTGCTACTCACAGGTGAACGAGTGCCTGAGCAATCCCTGCATCCACGGAAACTGTACTGGAGGTCTCAGTGG - UN

I8342 - CTATAAGTGCCTCTGCGATGCAGGCTGGGTTGGTGTCAACTGTGAGGTGGACAAAAATGAGTGTCTTTCTAACCCATGCCAGAATGGAGGAA

CGTGCAATAACCTGGTGAATGGCTACAGGTGTACCTGCAAGAAGGGGTTCAAAG GCTACAACTGCCAGGTGAATATAGATGAGTGTGCCTCCAACCCGT

GTCTGAACCAAGGAACCTGCTTTGATGACGTCAGTGGCTACACTTGCCACTGCATGTTGCCTTACACAG GCAAGAACTGTCAAACAGTGTTGGCTCCCT

GTTCCCCAAACCCGTGTGAGAATGCTGCTGTTTGTAAAGAGGCACCCAATTTTGAGAGCTTCAGCTGCTTGTGTGCTCCTGGCTGGCAAG GTAAACGAT

GTACAGTTGACGTTGATGAGTGTATCTCCAAGCCGTGTATGAACAATGGTGTCTGCCACAACACTCAGGGCAGCTACGTGTGTGAGTGTCCTCCCGGCTT

CAGTGGGATGGACTGTGAAGAGGACATCAATGATTGCCTTGCCA ACCCCTGCCAGAACGGAGGCTCCTGTGTGGACCATGTGAATACCTTCTCCTGCCA

GTGCCATCCTGGCTTCATAGGGGACAAGTGCCAGACAGACATGAATGAGTGTCTGAGCGAGCCCTGTAAGAATGGGGGGACCTGCTCCGACTATGTCAAC

AGTTACACCTGCACATGCCCTGCGGGCTTCCACGGAGTCCACTGTGAAAACAACATTGACGAGTGCACTGAGAG - UNI10527 - CTCCTGCTTCAA

TGGCGGCACGTGTGTTGATGGAATCAACTCTTTCTCTTGCTTGTGCCCCGTGGGTTTCACTGGTCCCTTCTGCCTCCATGATATCAATGAGTGCAGCTCT

AACCCGTGCCTGAATGCTGGAACGTGTGTTGATGGTCTGGGTACCTACCGATGCATCTGTCCCTTGGGCTACACCGGGAAAAACTGTCAG ACCCTGGTG

AACCTCTGCAGCCGGTCTCCGTGTAAAAACAAAGGAACTTGTGTTCAGGAAAAGGCAAGGCCCCACTGTCTGTGTCCGCCTGGATGGGATGGTGCATACT

GTGATGTGCTCAACGTGTCCTGTAAGGCGGCAGCCTTGCAGAAAG GAGTACCTGTTGAACACTTGTGCCAGCACTCGGGCATCTGTATCAATGCTGGCA

ACACCCATCACTGCCAGTGCCCCCTGGGCTACACGGGGAGCTACTGCGAGGAGCAGCTTGATGAGTGTGCATCCAATCCATGCCAGCACGGTGCCACCTG

CAATGACTTCATCGGAGGATACAGATGTGAG TGTGTTCCAGGATATCAGGGTGTCAACTGTGAGTATGAAGTGGACGAGTGCCAGAACCAACCCTGCCA

GAATGGAGGCACCTGCATCGACCTTGTGAACCATTTCAAGTGTTCGTGTCCCCCAGGCACCCGGG GCCTGCTGTGTGAAGAGAACATCGATGAATGTGC

TGGGGGCCCCCACTGCCTTAACGGTGGCCAGTGCGTGGACCGGATTGGAGGCTACACTTGTCGCTGTTTGCCTGGCTTTGCTGGGGAGCGGTGTGAGGGG

GACATCAACGAATGCCTGTCCAACCCTTGCAGCTCAGAGGGCAGCCTGGACTGCGTTCAGCTCAAAAATAACTACAACTGTATCTGCCGCAGCGCCTTCA

CGG - UNI10227 - GCCGGCACTGTGAAACCT ACCACTTCAAAGACAACCACTGTGATCAGGGATGCAACAGCGAGGAGTGTGGCTGGGATGGGCT

GGACTGCGCTTCGGACCAGCCTGAGAACCTGGCAGAGGGCACCCTGATCATCGTGGTGCTCCTGCCCCCTGAACAGCTGCTGCAGGATTCGCGAAGCTTC

TTGAGGGCCCTGGGCACCCTGCTCCACACCAACTTGCGCATTAAACAAGATTCTCAGGGCGCTCTCATGGTGTACCCCTACTTTGGGGAGAAGTCAGCTG

CCATGAAGAAGCAGAAGATGACACGCAGGTCTCTTCCTGAGGAGCAGGAGCAGGAGCAGGAGGTGATAGG CTCTAAGATATTTCTGGAGATCGACAACC

GACAGTGTGTTCAAGATTCAGACCAGTGCTTCAAAAACACAGATGCGGCAGCTGCTCTCCTGGCTTCTCATGCCATCCAAGGGACCCTATCCTACCCTCT

AGTGTCTGTTTTCA GTGAACTGGAGAGTCCAAGAAACGCCCAGCTTCTCTATCTGCTCGCGGTCGCTGTTGTCATCATCCTGTTCTTCATCCTGCTGGG

GGTCATCATGGCCAAGCGG CAAGCATGGCTTCCTCTGGCTGCCGGA TTCACCCTCCGCCGAGACTCTAGCAATCACAAGCGCCGTGAACCTGTGGGAC

AGGATGCCGTGGGGCTGAA AAATCTCTCCGTGCAAGTGTCAGAGGCTAACCTGATTGGTTCTGGGACAAGTGAACATTGGGTTGATGATGAAGGACCCC

AGCCAAAGAAAGCCAAG - UNI2283 - GCTGAGGATGAGGCTTTGCTGTCGGAAGATGACCCCATCGATCGACGGCCCTGGACACAGCAGCACCTTG

AAGCTGCAGACATCCGCCACACTCCATCCCTGGCACTCACTCCTCCTCAGGCAGAACAGGAGGTGGACGTGCTGGACGTGAATGTCCGAGGCCCAG ATG

GGTGTACTCCACTGATGCTGGCTTCTCTCCGAGGAGGCAGCTCAGACCTGAGTGATGAAGACGAAGATGCTGAGGACTCTTCTGCCAACATCATCACAGA

CTTGGTCTACCAAGGTGCCAGCCTTCAAGCACAGACAGACCGCACTGGCGAGATGGCCCTGCACCTTGCAGCCCGCTATTCGAGAGCTGATGCTGCCAAA

CGCCTCCTGGATGCTGGTGCGGATGCAAATGCCCAGGACAACATGGGCCGATGTCCTCTTCACGCTGCGGTGGCAGCAGACGCCCAAGGTGTCTTTCAG 

ATTCTGATCCGCAACCGTGTAACCGATCTGGATGCCAGAATGAACGATGGTACTACCCCCCTGATCCTGGCTGCCCGCCTGGCTGTGGAAGGAATGGTGG

CAGAGTTGATCAATTGCCAAGCAGATGTCAATGCAGTGGATGACCATG GAAAATCTGCCCTCCACTGGGCAGCTGCTGTCAATAATGTGGAGGCGACTC

TTCTGCTGTTGAAGAATGGGGCCAACAGAGATATGCAGGACAATAAG GAAGAGACACCTTTGTTTCTTGCTGCCCGAGAGGGAAGTTATGAAGCGGCCA

AAATCCTGTTAGACCATTTTGCCAACCGGGACATCACTGACCACATGGACCGCCTTCCCCGGGATGTGGCTCGGGACCGCATGCACCATGACATCGTTCG

CCTCCTGGACGAGTATAACGTGACTCCCAGCCCTCCGGGAACGGTCTTGACTTCTGCGCTCTCACCTGTCCTCTGTGGGCCCAACAGGTCTTTCCTCAGT

CTGAAGCACACCCCAATGGGTAAGAAGGCTAGGCGGCCCAACACCAAGAGCACCATGCCCACGAGCCTGCCTAACCTTGCCAAGGAGGCCAAGGATGCCA

AGGGCAGCAGGAGGAAGAAGTGTCTGAACGAGAAGGTCCAGCTGTCCGAGAGCTCAGTGACTCTATCCCCCGTCGATTCGCTCGAGTCTCCTCACACGTA

TGTCTCCGATGCCACATCCTCTCCCATGATCACATCCCCTGGAATCTTACAGGCCTCGCCCACCCCCCTGCTGGCTGCTGCCGCCCCGGCTGCCCCAGTG

CACACACAGCATGCGCTGTCTTTCTCTAACCTTCATGACATGCAGCCTTTGGCTCCTGGAGCCAGCACCGTGCTCCCCTCGGTCAGCCAGCTGCTATCCC

ACCACCACATCGCGCCCCCAGGTAGTAGCAGTGCAGGAAGCTTGGGCAGGTTACATCCAGTTCCTGTCCCAGCAGACTGGATGAACCGTGTGGAGATGAA

CGAGACCCAGTACAGTGAAATGTTTGGCATGGTCCTGGCTCCTGCAGAGGGAGCCCACCCTGGCATAGCAGCTCCCCAGAGCAGACCTCCGGAAGGGAAG

CACATGTCCACCCAGCGGGAGCCCTTGCCTCCCATCGTGACTTTCCAGCTTATCCCAAAAGGCAGCATTGCCCAGGCAGCCGGAGCTCCCCAGACGCAGT

CCAGTTGCCCTCCAGCTGTTGCAGGCCCCTTGCCCTCTATGTACCAGATCCCAGAGATGCCCCGTTTGCCCAGTGTGGCTTTCCCACCTACCATGATGCC

CCAGCAGGAGGGGCAGGTAGCTCAGACCATTGTGCCAACCTATCATCCTTTCCCAGCCTCTGTGGGCAAGTACCCCACACCCCCTTCCCAACACAGTTAC

GCCTCCTCAAATGCTGCTGAGCGAACCCCCAGTCATGGTGGTCACCTCCAGGGCGAGCACCCATACCTGACACCATCCCCAGAGTCTCCTGACCAATGGT

CAAGCTCTTCACCACACTCTGCATCTGACTGGTCAGATGTGACCACCAGCCCAACTCCTGGAGGTGGTGGAGGCGGTCAGCGGGGACCCGGAACACACAT

GTCCGAGCCACCACACAGCAACATGCAGGTGTATGCATGA
Translation
ALQCRGGQEPCVNEGTCVTYHNGTGFCR - UNI9479 - RCPEGFLGEYCQHRDPCEKNRCQNGGTCVPQGMLGKATCRCAPGFTGEDCQYSTSHPCF

VSRPCQNGGTCHMLSRDTYECTCQVGFTG GKQCQWTDACLSHPCENGSTCTSVASQFSCKCPAGLTGQKCEADINECDIPGRCQHGGTCLNLPGSYRCQ

CPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTGDFTFECNCLPG GFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTG - UNI9822 - G

QFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCIDRVASFSCLCPEGKAG GLLCHLDDACISNPCHKGALC

DTNPLNGQYICTCPQGYKGADCTEDVDECAMA ANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPG GF

KGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPG GFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATG GFTGILCDENIDNCDPDPCHHG

QCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSG GLNCEINFDDCASNPCMHGVCVDGINRYSCVCSPGFTG - U

NI10229 - GQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSG - UNI8342 - GYKCLCDAGWVG

VNCEVDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKG GYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTG GKNCQTVLAPCSPNPCENAAV

CKEAPNFESFSCLCAPGWQG GKRCTVDVDECISKPCMNNGVCHNTQGSYVCECPPGFSGMDCEEDINDCLAN NPCQNGGSCVDHVNTFSCQCHPGFIG

DKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDECTES - UNI10527 - SSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINE

CSSNPCLNAGTCVDGLGTYRCICPLGYTGKNCQ TLVNLCSRSPCKNKGTCVQEKARPHCLCPPGWDGAYCDVLNVSCKAAALQKG GVPVEHLCQHSGI

CINAGNTHHCQCPLGYTGSYCEEQLDECASNPCQHGATCNDFIGGYRCE CVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRG GLLC

EENIDECAGGPHCLNGGQCVDRIGGYTCRCLPGFAGERCEGDINECLSNPCSSEGSLDCVQLKNNYNCICRSAFTG - UNI10227 - GRHCETY YH

FKDNHCDQGCNSEECGWDGLDCASDQPENLAEGTLIIVVLLPPEQLLQDSRSFLRALGTLLHTNLRIKQDSQGALMVYPYFGEKSAAMKKQKMTRRSLPE

EQEQEQEVIG GSKIFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVFS SELESPRNAQLLYLLAVAVVIILFFILLGVIMAKR QAW

LPLAAG FTLRRDSSNHKRREPVGQDAVGLK KNLSVQVSEANLIGSGTSEHWVDDEGPQPKKAK - UNI2283 - AEDEALLSEDDPIDRRPWTQQH

LEAADIRHTPSLALTPPQAEQEVDVLDVNVRGPD DGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYSRAD

AAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQ ILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHG GKSALHWAAAVN

NVEATLLLLKNGANRDMQDNK EETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVLCGP

NRSFLSLKHTPMGKKARRPNTKSTMPTSLPNLAKEAKDAKGSRRKKCLNEKVQLSESSVTLSPVDSLESPHTYVSDATSSPMITSPGILQASPTPLLAAA

APAAPVHTQHALSFSNLHDMQPLAPGASTVLPSVSQLLSHHHIAPPGSSSAGSLGRLHPVPVPADWMNRVEMNETQYSEMFGMVLAPAEGAHPGIAAPQS

RPPEGKHMSTQREPLPPIVTFQLIPKGSIAQAAGAPQTQSSCPPAVAGPLPSMYQIPEMPRLPSVAFPPTMMPQQEGQVAQTIVPTYHPFPASVGKYPTP

PSQHSYASSNAAERTPSHGGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGGGGGQRGPGTHMSEPPHSNMQVYA
Transcript ENSMUST00000079812
Sequence
GCTTTGCAGTGTCGAGGTGGTCAAGAGCCCTGTGTAAATGAAGGGACCTGTGTTACCTACCACAACGGCACAGGCTTCTGCCG - UNI9479 - ATGT

CCAGAGGGCTTCTTGGGAGAATATTGCCAACATCGAGACCCCTGTGAGAAAAACCGCTGTCAGAATGGTGGTACTTGTGTGCCGCAGGGCATGTTGGGGA

AAGCTACCTGCCGATGTGCTCCAGGATTCACAGGAGAGGACTGCCAATACTCCACCTCTCACCCCTGCTTTGTGTCCCGCCCTTGTCAGAATGGGGGTAC

CTGTCACATGCTCAGCCGGGACACCTACGAGTGCACCTGCCAAGTCGGCTTCACAG GGAAGCAGTGTCAGTGGACAGATGCCTGTCTATCTCATCCCTG

CGAAAATGGAAGCACCTGTACATCTGTGGCCAGCCAGTTCTCCTGCAAATGCCCTGCAGGCCTCACAGGGCAGAAGTGTGAAGCTGATATCAATGAGTGT

GACATTCCAGGACGCTGCCAACATGGTGGCACCTGCCTCAACCTTCCTGGTTCCTACAGATGCCAATGTCCTCAGGGCTTCACAGGCCAGCACTGTGACA

GCCCTTATGTGCCCTGTGCACCCTCGCCCTGCGTCAACGGAGGCACCTGTCGTCAGACTGGCGACTTCACTTTCGAATGCAACTGCCTGCCAG GTTTTG

AAGGGAGCACCTGTGAGCGGAATATCGACGACTGCCCCAACCACAAGTGTCAGAATGGAGGAGTTTGTGTGGATGGTGTCAATACCTACAATTGCCGCTG

TCCCCCTCAGTGGACTG - UNI9822 - GGCAGTTCTGCACAGAAGATGTGGACGAGTGTCTGTTGCAGCCCAACGCTTGTCAGAATGGAGGCACCTG

CACCAACCGAAACGGAGGCTATGGCTGCGTGTGTGTGAACGGCTGGAGCGGAGATGACTGCAGCGAGAATATCGATGACTGTGCCTATGCTTCCTGCACG

CCAGGGTCCACCTGCATTGACCGCGTGGCCTCCTTCTCCTGCCTGTGTCCGGAGGGAAAGGCGG GTCTCCTGTGCCATCTGGATGATGCCTGTATCAGC

AACCCTTGTCACAAGGGGGCGCTGTGTGACACCAACCCCCTGAACGGGCAGTACATTTGCACCTGCCCACAGGGCTACAAGGGCGCTGACTGCACAGAAG

ACGTGGATGAGTGTGCTATGG CCAACAGTAACCCTTGTGAGCATGCAGGAAAGTGTGTGAATACAGATGGCGCCTTCCACTGTGAGTGTCTGAAGGGCT

ACGCAGGGCCTCGCTGTGAGATGGACATCAACGAGTGTCATTCAGACCCCTGCCAGAACGACGCCACCTGCCTGGATAAGATCGGAGGCTTCACCTGTCT

GTGCATGCCAG GTTTCAAAGGTGTGCATTGTGAGCTGGAGGTAAATGAATGCCAGAGCAACCCGTGTGTGAACAACGGGCAGTGTGTGGACAAAGTCAA

CCGCTTCCAGTGTCTGTGTCCCCCTG GCTTCACAGGACCAGTGTGCCAGATCGACATTGATGACTGCTCCAGTACTCCCTGCCTGAATGGGGCCAAGTG

CATCGATCACCCGAATGGCTATGAATGCCAGTGTGCCACAG GTTTCACTGGCATATTGTGTGATGAGAACATCGACAACTGTGACCCAGATCCTTGCCA

CCATGGCCAGTGCCAGGATGGGATCGACTCCTACACCTGCATCTGCAACCCTGGGTACATGGGAGCCATCTGTAGTGACCAGATTGATGAATGCTACAGC

AGCCCTTGCTTGAACGATGGGCGCTGCATTGACCTGGTGAATGGTTACCAGTGCAACTGCCAACCAGGCACATCAG GCCTTAATTGTGAAATTAATTTT

GATGACTGTGCCAGCAACCCTTGTATGCACGGAGTCTGTGTGGACGGCATCAATCGCTACAGCTGTGTGTGCTCTCCGGGATTCACAG - UNI10229 

- GCCAGAGGTGCAATATTGACATTGATGAGTGTGCCTCCAACCCCTGTCGCAAGGGTGCGACGTGCATCAATGATGTGAATGGTTTCCGGTGTATATGC

CCCGAGGGACCGCATCATCCTAGCTGCTACTCACAGGTGAACGAGTGCCTGAGCAATCCCTGCATCCACGGAAACTGTACTGGAGGTCTCAGTGG - UN

I8342 - CTATAAGTGCCTCTGCGATGCAGGCTGGGTTGGTGTCAACTGTGAGGTGGACAAAAATGAGTGTCTTTCTAACCCATGCCAGAATGGAGGAA

CGTGCAATAACCTGGTGAATGGCTACAGGTGTACCTGCAAGAAGGGGTTCAAAG GCTACAACTGCCAGGTGAATATAGATGAGTGTGCCTCCAACCCGT

GTCTGAACCAAGGAACCTGCTTTGATGACGTCAGTGGCTACACTTGCCACTGCATGTTGCCTTACACAG GCAAGAACTGTCAAACAGTGTTGGCTCCCT

GTTCCCCAAACCCGTGTGAGAATGCTGCTGTTTGTAAAGAGGCACCCAATTTTGAGAGCTTCAGCTGCTTGTGTGCTCCTGGCTGGCAAG GTAAACGAT

GTACAGTTGACGTTGATGAGTGTATCTCCAAGCCGTGTATGAACAATGGTGTCTGCCACAACACTCAGGGCAGCTACGTGTGTGAGTGTCCTCCCGGCTT

CAGTGGGATGGACTGTGAAGAGGACATCAATGATTGCCTTGCCA ACCCCTGCCAGAACGGAGGCTCCTGTGTGGACCATGTGAATACCTTCTCCTGCCA

GTGCCATCCTGGCTTCATAGGGGACAAGTGCCAGACAGACATGAATGAGTGTCTGAGCGAGCCCTGTAAGAATGGGGGGACCTGCTCCGACTATGTCAAC

AGTTACACCTGCACATGCCCTGCGGGCTTCCACGGAGTCCACTGTGAAAACAACATTGACGAGTGCACTGAGAG - UNI10527 - CTCCTGCTTCAA

TGGCGGCACGTGTGTTGATGGAATCAACTCTTTCTCTTGCTTGTGCCCCGTGGGTTTCACTGGTCCCTTCTGCCTCCATGATATCAATGAGTGCAGCTCT

AACCCGTGCCTGAATGCTGGAACGTGTGTTGATGGTCTGGGTACCTACCGATGCATCTGTCCCTTGGGCTACACCGGGAAAAACTGTCAG ACCCTGGTG

AACCTCTGCAGCCGGTCTCCGTGTAAAAACAAAGGAACTTGTGTTCAGGAAAAGGCAAGGCCCCACTGTCTGTGTCCGCCTGGATGGGATGGTGCATACT

GTGATGTGCTCAACGTGTCCTGTAAGGCGGCAGCCTTGCAGAAAG GAGTACCTGTTGAACACTTGTGCCAGCACTCGGGCATCTGTATCAATGCTGGCA

ACACCCATCACTGCCAGTGCCCCCTGGGCTACACGGGGAGCTACTGCGAGGAGCAGCTTGATGAGTGTGCATCCAATCCATGCCAGCACGGTGCCACCTG

CAATGACTTCATCGGAGGATACAGATGTGAG TGTGTTCCAGGATATCAGGGTGTCAACTGTGAGTATGAAGTGGACGAGTGCCAGAACCAACCCTGCCA

GAATGGAGGCACCTGCATCGACCTTGTGAACCATTTCAAGTGTTCGTGTCCCCCAGGCACCCGGG GCCTGCTGTGTGAAGAGAACATCGATGAATGTGC

TGGGGGCCCCCACTGCCTTAACGGTGGCCAGTGCGTGGACCGGATTGGAGGCTACACTTGTCGCTGTTTGCCTGGCTTTGCTGGGGAGCGGTGTGAGGGG

GACATCAACGAATGCCTGTCCAACCCTTGCAGCTCAGAGGGCAGCCTGGACTGCGTTCAGCTCAAAAATAACTACAACTGTATCTGCCGCAGCGCCTTCA

CGG - UNI10227 - GCCGGCACTGTGAAACCTTCCTAGATGTGTGTCCCCAGAAGCCTTGCCTGAACGGAGGGACTTGTGCCGTGGCTAGCAACATG

CCCGATGGCTTCATCTGTCGTTGTCCCCCA GGGTTCTCTGGGGCGAGATGCCAGAGCAGCTGTGGACAAGTGAAGTGCAGGAGAGGGGAGCAGTGTATC

CACACTGACTCGGGACCTCGCTGCTTCTGCCTGAACCCCAAGGACTGCGAGTCAGGATGTGCCAGTAACCCCTGCCAGCATGGGGGCACCTGCTATCCTC

AGCGCCAGCCTCCTCACTATTCCTGCCGCTGCCCTCCGTCGTTCGGGGGCAGCCACTGCGAACTCTACACAGCCCCCACCAGCACCCCTCCTGCTACCTG

TCAGAGTCAGTACTGCGCCGACAAGGCTCGGGATGGCATCTGTGACGAGGCCTGCAATAGTCATGCCTGCCAGTGGGATGGAGGTGACTGTTCCCTCACT

ATGGAGGACCCCTGGGCCAACTGCACCTCCACTCTTCGCTGCTGGGAATACATCAACAACCAGTGTGATGAGCAGTGCAACACCGCAGAGTGCCTGTTTG

ACAACTTTGAGTGCCAGAGGAATAGCAAGACGTGCAA GTATGACAAATACTGTGCAGACCACTTCAAAGACAACCACTGTGATCAGGGATGCAACAGCG

AGGAGTGTGGCTGGGATGGGCTGGACTGCGCTTCGGACCAGCCTGAGAACCTGGCAGAGGGCACCCTGATCATCGTGGTGCTCCTGCCCCCTGAACAGCT

GCTGCAGGATTCGCGAAGCTTCTTGAGGGCCCTGGGCACCCTGCTCCACACCAACTTGCGCATTAAACAAGATTCTCAGGGCGCTCTCATGGTGTACCCC

TACTTTGGGGAGAAGTCAGCTGCCATGAAGAAGCAGAAGATGACACGCAGGTCTCTTCCTGAGGAGCAGGAGCAGGAGCAGGAGGTGATAGG CTCTAAG

ATATTTCTGGAGATCGACAACCGACAGTGTGTTCAAGATTCAGACCAGTGCTTCAAAAACACAGATGCGGCAGCTGCTCTCCTGGCTTCTCATGCCATCC

AAGGGACCCTATCCTACCCTCTAGTGTCTGTTTTCA GTGAACTGGAGAGTCCAAGAAACGCCCAGCTTCTCTATCTGCTCGCGGTCGCTGTTGTCATCA

TCCTGTTCTTCATCCTGCTGGGGGTCATCATGGCCAAGCGG CAAGCATGGCTTCCTCTGGCTGCCGGA TTCACCCTCCGCCGAGACTCTAGCAATCAC

AAGCGCCGTGAACCTGTGGGACAGGATGCCGTGGGGCTGAA AAATCTCTCCGTGCAAGTGTCAGAGGCTAACCTGATTGGTTCTGGGACAAGTGAACAT

TGGGTTGATGATGAAGGACCCCAGCCAAAGAAAGCCAAG - UNI2283 - GCTGAGGATGAGGCTTTGCTGTCGGAAGATGACCCCATCGATCGACGG

CCCTGGACACAGCAGCACCTTGAAGCTGCAGACATCCGCCACACTCCATCCCTGGCACTCACTCCTCCTCAGGCAGAACAGGAGGTGGACGTGCTGGACG

TGAATGTCCGAGGCCCAG ATGGGTGTACTCCACTGATGCTGGCTTCTCTCCGAGGAGGCAGCTCAGACCTGAGTGATGAAGACGAAGATGCTGAGGACT

CTTCTGCCAACATCATCACAGACTTGGTCTACCAAGGTGCCAGCCTTCAAGCACAGACAGACCGCACTGGCGAGATGGCCCTGCACCTTGCAGCCCGCTA

TTCGAGAGCTGATGCTGCCAAACGCCTCCTGGATGCTGGTGCGGATGCAAATGCCCAGGACAACATGGGCCGATGTCCTCTTCACGCTGCGGTGGCAGCA

GACGCCCAAGGTGTCTTTCAG ATTCTGATCCGCAACCGTGTAACCGATCTGGATGCCAGAATGAACGATGGTACTACCCCCCTGATCCTGGCTGCCCGC

CTGGCTGTGGAAGGAATGGTGGCAGAGTTGATCAATTGCCAAGCAGATGTCAATGCAGTGGATGACCATG GAAAATCTGCCCTCCACTGGGCAGCTGCT

GTCAATAATGTGGAGGCGACTCTTCTGCTGTTGAAGAATGGGGCCAACAGAGATATGCAGGACAATAAG GAAGAGACACCTTTGTTTCTTGCTGCCCGA

GAGGGAAGTTATGAAGCGGCCAAAATCCTGTTAGACCATTTTGCCAACCGGGACATCACTGACCACATGGACCGCCTTCCCCGGGATGTGGCTCGGGACC

GCATGCACCATGACATCGTTCGCCTCCTGGACGAGTATAACGTGACTCCCAGCCCTCCGGGAACGGTCTTGACTTCTGCGCTCTCACCTGTCCTCTGTGG

GCCCAACAGGTCTTTCCTCAGTCTGAAGCACACCCCAATGGGTAAGAAGGCTAGGCGGCCCAACACCAAGAGCACCATGCCCACGAGCCTGCCTAACCTT

GCCAAGGAGGCCAAGGATGCCAAGGGCAGCAGGAGGAAGAAGTGTCTGAACGAGAAGGTCCAGCTGTCCGAGAGCTCAGTGACTCTATCCCCCGTCGATT

CGCTCGAGTCTCCTCACACGTATGTCTCCGATGCCACATCCTCTCCCATGATCACATCCCCTGGAATCTTACAGGCCTCGCCCACCCCCCTGCTGGCTGC

TGCCGCCCCGGCTGCCCCAGTGCACACACAGCATGCGCTGTCTTTCTCTAACCTTCATGACATGCAGCCTTTGGCTCCTGGAGCCAGCACCGTGCTCCCC

TCGGTCAGCCAGCTGCTATCCCACCACCACATCGCGCCCCCAGGTAGTAGCAGTGCAGGAAGCTTGGGCAGGTTACATCCAGTTCCTGTCCCAGCAGACT

GGATGAACCGTGTGGAGATGAACGAGACCCAGTACAGTGAAATGTTTGGCATGGTCCTGGCTCCTGCAGAGGGAGCCCACCCTGGCATAGCAGCTCCCCA

GAGCAGACCTCCGGAAGGGAAGCACATGTCCACCCAGCGGGAGCCCTTGCCTCCCATCGTGACTTTCCAGCTTATCCCAAAAGGCAGCATTGCCCAGGCA

GCCGGAGCTCCCCAGACGCAGTCCAGTTGCCCTCCAGCTGTTGCAGGCCCCTTGCCCTCTATGTACCAGATCCCAGAGATGCCCCGTTTGCCCAGTGTGG

CTTTCCCACCTACCATGATGCCCCAGCAGGAGGGGCAGGTAGCTCAGACCATTGTGCCAACCTATCATCCTTTCCCAGCCTCTGTGGGCAAGTACCCCAC

ACCCCCTTCCCAACACAGTTACGCCTCCTCAAATGCTGCTGAGCGAACCCCCAGTCATGGTGGTCACCTCCAGGGCGAGCACCCATACCTGACACCATCC

CCAGAGTCTCCTGACCAATGGTCAAGCTCTTCACCACACTCTGCATCTGACTGGTCAGATGTGACCACCAGCCCAACTCCTGGAGGTGGTGGAGGCGGTC

AGCGGGGACCCGGAACACACATGTCCGAGCCACCACACAGCAACATGCAGGTGTATGCATGA
Translation
ALQCRGGQEPCVNEGTCVTYHNGTGFCR - UNI9479 - RCPEGFLGEYCQHRDPCEKNRCQNGGTCVPQGMLGKATCRCAPGFTGEDCQYSTSHPCF

VSRPCQNGGTCHMLSRDTYECTCQVGFTG GKQCQWTDACLSHPCENGSTCTSVASQFSCKCPAGLTGQKCEADINECDIPGRCQHGGTCLNLPGSYRCQ

CPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTGDFTFECNCLPG GFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTG - UNI9822 - G

QFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCIDRVASFSCLCPEGKAG GLLCHLDDACISNPCHKGALC

DTNPLNGQYICTCPQGYKGADCTEDVDECAMA ANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPG GF

KGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPG GFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATG GFTGILCDENIDNCDPDPCHHG

QCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSG GLNCEINFDDCASNPCMHGVCVDGINRYSCVCSPGFTG - U

NI10229 - GQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSG - UNI8342 - GYKCLCDAGWVG

VNCEVDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKG GYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTG GKNCQTVLAPCSPNPCENAAV

CKEAPNFESFSCLCAPGWQG GKRCTVDVDECISKPCMNNGVCHNTQGSYVCECPPGFSGMDCEEDINDCLAN NPCQNGGSCVDHVNTFSCQCHPGFIG

DKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDECTES - UNI10527 - SSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINE

CSSNPCLNAGTCVDGLGTYRCICPLGYTGKNCQ TLVNLCSRSPCKNKGTCVQEKARPHCLCPPGWDGAYCDVLNVSCKAAALQKG GVPVEHLCQHSGI

CINAGNTHHCQCPLGYTGSYCEEQLDECASNPCQHGATCNDFIGGYRCE CVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRG GLLC

EENIDECAGGPHCLNGGQCVDRIGGYTCRCLPGFAGERCEGDINECLSNPCSSEGSLDCVQLKNNYNCICRSAFTG - UNI10227 - GRHCETFLDV

CPQKPCLNGGTCAVASNMPDGFICRCPP GFSGARCQSSCGQVKCRRGEQCIHTDSGPRCFCLNPKDCESGCASNPCQHGGTCYPQRQPPHYSCRCPPSF

GGSHCELYTAPTSTPPATCQSQYCADKARDGICDEACNSHACQWDGGDCSLTMEDPWANCTSTLRCWEYINNQCDEQCNTAECLFDNFECQRNSKTCK K

YDKYCADHFKDNHCDQGCNSEECGWDGLDCASDQPENLAEGTLIIVVLLPPEQLLQDSRSFLRALGTLLHTNLRIKQDSQGALMVYPYFGEKSAAMKKQK

MTRRSLPEEQEQEQEVIG GSKIFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVFS SELESPRNAQLLYLLAVAVVIILFFILLGVI

MAKR QAWLPLAAG FTLRRDSSNHKRREPVGQDAVGLK KNLSVQVSEANLIGSGTSEHWVDDEGPQPKKAK - UNI2283 - AEDEALLSEDDPID

RRPWTQQHLEAADIRHTPSLALTPPQAEQEVDVLDVNVRGPD DGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMALHL

AARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQ ILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHG GKSA

LHWAAAVNNVEATLLLLKNGANRDMQDNK EETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSA

LSPVLCGPNRSFLSLKHTPMGKKARRPNTKSTMPTSLPNLAKEAKDAKGSRRKKCLNEKVQLSESSVTLSPVDSLESPHTYVSDATSSPMITSPGILQAS

PTPLLAAAAPAAPVHTQHALSFSNLHDMQPLAPGASTVLPSVSQLLSHHHIAPPGSSSAGSLGRLHPVPVPADWMNRVEMNETQYSEMFGMVLAPAEGAH

PGIAAPQSRPPEGKHMSTQREPLPPIVTFQLIPKGSIAQAAGAPQTQSSCPPAVAGPLPSMYQIPEMPRLPSVAFPPTMMPQQEGQVAQTIVPTYHPFPA

SVGKYPTPPSQHSYASSNAAERTPSHGGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGGGGGQRGPGTHMSEPPHSNMQVYA

For any suggestions or comments, please send an email to unitrap@crg.es