Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027884 (Clcc1)
Chromosomal location
Chr 3: 108456831 - 108481758 (+)
Description
chloride channel CLIC-like 1 Gene [Source:MGI (curated);Acc:Clcc1-002]
RefSeq_dna
NM_145543 
RefSeq_peptide
NP_663518.1 
UniGene
Mm.214545 
MGI
MGI:2385186 
Uniprot/SWISSPROT
Q99LI2 
Uniprot/SPTREMBL
A2AEM2 
Human Ortholog
ENSG00000121940 (CLCC1)
Omim not available
UniTrap UNI22204
Vector Insertion
Chr 3: 108464272 - 108464414
Public Clones not available
Private Clones OST303521 (lexicon) OST194722 (lexicon) OST98971 (lexicon) OST90571 (lexicon)
OST55136 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4329
Vector Insertion
Chr 3: 108476346 - 108477554
Public Clones AF0617 (sanger) AF0834 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106609
Sequence
GCACAGCTGCGGGCCGAGCGAGTCGATGAGTCCGCTCGGGACTCCAGTCCGAGTGCACCGTGTTTGAG - UNI22204 - GCCTTATTCAGGATGCTG

TGTCGGCTGCTCCTTTGTGAATGTCTGTTGCTGATAACGGGTTATGCTCATGATGACGACTGGATTGACCCAACAGATATGCTTAACTATGACGCTGCTT

CAGGAACGATGAGGAAATCTCAG - UNI22204 - GTGAGGTCTGGAACATCAGAGAAGAAGGAAGTGAGCCCTGACTCGTCAGAAGCCGAGGAACTG

TCAGACTGTTTGCACAGACTGGATTCTTTAACTCACAAG GTTGATAGTTGTGAAAAGAAGAAAATGAAAGATTATGAAAGTCAAAGTAATCCTGTTTTC

AGGAGATATCTAAATAAGATTTTAATTGAAGCTGGCAAGCTTGGACTC CCTGATGAGAACAAAGTAGAGATGCGTTACGATGCTGAGATTCTCCTGAGC

AGACAGACACTGTTGGAGATTCAGAAGTTCCTCAGCGGAGAGGAGTGGAAGCCCGGAGCCCTGGACGACGCACTAAGTGACATTTTAATCAATTTTAAGT

GCCATGATTCAGAAGCATGGAAGTGGCAGTTTGAAGATTATTTTGGAGTAGATCCATATAATGTGTTTATG GTTCTCTTGTGTCTGCTCTGCCTTGTGG

TGCTGGTGGCTACAGAGCTGTGGACTTATGTTCGCTGGTACACACAGATGAAACGGATTTTCATCATCAGCTTTCTCTTGAGTTTAGCATGGAATTGGAT

ATATCTGTATAAG ATGGCTTTTGCTCAGCATCAGGCTAACATTGCTGGGATGGAGCCTTTCGACAATTTATGTGCTAAGAAGATGGATTGGACTGGAAG

TCTCTGGG AATGGTTTACAAGTTCATGGACCTATAAGGATGACCCATGCCAAAAGTACTATGAGCTCCTAATAGTCAACCCTATTTGGTTGGTTCCACC

AACAAAG GCTCTGGCGATTACATTCACTAACTTTGTAACGGAACCATTAAAGCACATTGGAAAAGGAGCAGGTGAATTCATTAAAGCGCTCATGAAGGA

GATTCCAGTGTTACTTCAGATTCCGGTGCTGGCGATCCTGGCGCTGGCTGTCCTG - UNI4329 - AGCTTCTGCTATGGTGCTGGAAGGTCAGTTCC

TATGCTGAGACACTTCGGTGGTCCTGACAGAGAACCTCCCCGAGCACTTGAGCCAGATGACAGAAGACGACAGAAGGGACTTGACTATAGACTCCATGGT

GGAGCAGGTGATGCAGATTTCTCTTACAGGGGCCCAGCTGGCTCCATCGAGCAAGGCCCTTATGACAAAATGCATGCGAGTAAGAGAGATGCTTTGAGAC

AGAGATTTCACTCTGGCAACAAGAGCCCTGAAGTGCTCCGGGCATTTGACTTACCTGACACAGAGGCACAAGAACATCCAGAAGTGGTCCCCAGC CATA

AATCACCCATTATGAACACAAACCTTGAGACTGGTGAACTCCCAGGAGAAAGCACCCCGACAGAATACAGCCAGTCTGCCAAGGATGTCTCTGGCCAAGT

TCCCAGCGCTGGCAAAAGCTCACCCACAGTGGACAAGGCCCAGCTGAAGACAGACTCCGAGTGCAGCCCACCAGGAGGCTGCCCACCCAGCAAGGAAGCT

GCAGTGGCAGCACACGGGACTGAACCTGTCAGCAGCCCATGTGGCTAAAGAACAATGCACAGAGCAACCACAGCTCCAGCCATCTTTGAA ATGCCCATT

TGGGGATGGAATCTACCTTGACAGCTAGCAAAGCAACCTGCTGTTCTTGAGTGACTACAGCAATTCAGGGAAGACTTGATTAACACAGGTGACGATATCA

AGGCCAGTTTATTGCAGAAAAGAGAAGCGGCTTGTCTCAAGTGATTAGTGTGACTATCTGAGGTTAAAGCACATTGTAACTGGCTTTTAAGAAAAGAACA

GGGTAGGTAGTTGTTAAAGCACTTTTTAAAACAGAATAATTGTTGAATGCTTAACCATTGTAAACACAAAATAAACACTTATTTTTACATTA
Translation
 - UNI22204 - MLCRLLLCECLLLITGYAHDDDWIDPTDMLNYDAASGTMRKSQ - UNI22204 - VRSGTSEKKEVSPDSSEAEELSDCLHRLD

SLTHK VDSCEKKKMKDYESQSNPVFRRYLNKILIEAGKLGL PDENKVEMRYDAEILLSRQTLLEIQKFLSGEEWKPGALDDALSDILINFKCHDSEAW

KWQFEDYFGVDPYNVFM VLLCLLCLVVLVATELWTYVRWYTQMKRIFIISFLLSLAWNWIYLYK MAFAQHQANIAGMEPFDNLCAKKMDWTGSLWE E

WFTSSWTYKDDPCQKYYELLIVNPIWLVPPTK ALAITFTNFVTEPLKHIGKGAGEFIKALMKEIPVLLQIPVLAILALAVL - UNI4329 - SFCYG

AGRSVPMLRHFGGPDREPPRALEPDDRRRQKGLDYRLHGGAGDADFSYRGPAGSIEQGPYDKMHASKRDALRQRFHSGNKSPEVLRAFDLPDTEAQEHPE

VVPS HKSPIMNTNLETGELPGESTPTEYSQSAKDVSGQVPSAGKSSPTVDKAQLKTDSECSPPGGCPPSKEAAVAAHGTEPVSSPCG 
Transcript ENSMUST00000029483
Sequence
GAGCATCCTTGCTTGTGTTATCTGAAACCTTGGCAGAATCTGCAACAAATACTGACGGCCAAAAAATTATATATATATATTGGATTTGTTGGAGTAATG 

- UNI22204 - GCCTTATTCAGGATGCTGTGTCGGCTGCTCCTTTGTGAATGTCTGTTGCTGATAACGGGTTATGCTCATGATGACGACTGGATTGAC

CCAACAGATATGCTTAACTATGACGCTGCTTCAGGAACGATGAGGAAATCTCAG - UNI22204 - GTGAGGTCTGGAACATCAGAGAAGAAGGAAGT

GAGCCCTGACTCGTCAGAAGCCGAGGAACTGTCAGACTGTTTGCACAGACTGGATTCTTTAACTCACAAG GTTGATAGTTGTGAAAAGAAGAAAATGAA

AGATTATGAAAGTCAAAGTAATCCTGTTTTCAGGAGATATCTAAATAAGATTTTAATTGAAGCTGGCAAGCTTGGACTC CCTGATGAGAACAAAGTAGA

GATGCGTTACGATGCTGAGATTCTCCTGAGCAGACAGACACTGTTGGAGATTCAGAAGTTCCTCAGCGGAGAGGAGTGGAAGCCCGGAGCCCTGGACGAC

GCACTAAGTGACATTTTAATCAATTTTAAGTGCCATGATTCAGAAGCATGGAAGTGGCAGTTTGAAGATTATTTTGGAGTAGATCCATATAATGTGTTTA

TG GTTCTCTTGTGTCTGCTCTGCCTTGTGGTGCTGGTGGCTACAGAGCTGTGGACTTATGTTCGCTGGTACACACAGATGAAACGGATTTTCATCATCA

GCTTTCTCTTGAGTTTAGCATGGAATTGGATATATCTGTATAAG ATGGCTTTTGCTCAGCATCAGGCTAACATTGCTGGGATGGAGCCTTTCGACAATT

TATGTGCTAAGAAGATGGATTGGACTGGAAGTCTCTGGG AATGGTTTACAAGTTCATGGACCTATAAGGATGACCCATGCCAAAAGTACTATGAGCTCC

TAATAGTCAACCCTATTTGGTTGGTTCCACCAACAAAG GCTCTGGCGATTACATTCACTAACTTTGTAACGGAACCATTAAAGCACATTGGAAAAGGAG

CAGGTGAATTCATTAAAGCGCTCATGAAGGAGATTCCAGTGTTACTTCAGATTCCGGTGCTGGCGATCCTGGCGCTGGCTGTCCTG - UNI4329 - A

GCTTCTGCTATGGTGCTGGAAGGTCAGTTCCTATGCTGAGACACTTCGGTGGTCCTGACAGAGAACCTCCCCGAGCACTTGAGCCAGATGACAGAAGACG

ACAGAAGGGACTTGACTATAGACTCCATGGTGGAGCAGGTGATGCAGATTTCTCTTACAGGGGCCCAGCTGGCTCCATCGAGCAAGGCCCTTATGACAAA

ATGCATGCGAGTAAGAGAGATGCTTTGAGACAGAGATTTCACTCTGGCAACAAGAGCCCTGAAGTGCTCCGGGCATTTGACTTACCTGACACAGAGGCAC

AAGAACATCCAGAAGTGGTCCCCAGC CATAAATCACCCATTATGAACACAAACCTTGAGACTGGTGAACTCCCAGGAGAAAGCACCCCGACAGAATACA

GCCAGTCTGCCAAGGATGTCTCTGGCCAAGTTCCCAGCGCTGGCAAAAGCTCACCCACAGTGGACAAGGCCCAGCTGAAGACAGACTCCGAGTGCAGCCC

ACCAGGAGGCTGCCCACCCAGCAAGGAAGCTGCAGTGGCAGCACACGGGACTGAACCTGTCAGCAGCCCATGTGGCTAAAGAACAATGCACAGAGCAACC

ACAGCTCCAGCCATCTTTGAAGTCTGTATTGACTCTTCATCCTTCCTTACAAATTTACTACAAAGCTGCCAACTTTAAATTAGTAATTTTACAGACCATC

AGAGTACCTCTTAGCTGTTAGGATATAGCTCATATTTTAGAACAAGGTTTTATAAAATTTACATTTTTAAGTTACTGCTTTAGCAGATAGACACCATTAA

GTGAGCTGATACTATCAGGCGTTTAACTAACATTAAATGTTTCTTTGGCTACACTGCTACATGACAGCTAGCAAAGCAGGAGCCAACTGATCAAAGTGTG

TTGGCTGACAGAAGTCCTCTGAAACCTAGTTTACTAACAGGGTATTTAATGCAGGCTGGGTCTGCTGCTGCCACAGAGTCAGGCACCTGTGTTTTTATGT

AGGCTACCTGCAGAACGACGTGACTTTCTGGTTATGGGGCCTGTCTCCTTGTCATCCATTCTACATTAGGTCTTACTAAGACAAGCCTGGATGGTCTGGT

TCTAGCGATACTTGAGTTTCACACTTTGTCAGTGACTGTGGGAATGGCTTTATTCTCTACCATGTAGTACCAGATTTAGAAAGCCCCATTTTCATGTTTG

GAATCGTGCAGTTGCTTTGATGCTATTCAGTTTACTATACTGTCTTGGCTAAATGTAATTCTGGTTTTCAGAGAGGTGTAGATAGAGAACAAGATGTATT

AACATTTTTGAGTCAACATTATGTTGGTGATTTTAAAGTGCATTCTCCATTTTATACCTTTAAAAAAGCAATTTATGTATTTTGTACACGTCCTAGCTAG

CACTCTTTCTGTGCACGCAGGTGTCCTTTGTTGTTGCAACCATATCTACACTGCACATTTTATTCAGATGAGACCGCTCAAGAATTAAGTCTTGAAATTA

ATTACCAGGCAGGCTGCTTCAACAAGGACATTTTGTCTGAACAGTTGATTTTTGATTTCTTTCTACAAATGTGTGATCCTCCTTTTTTTTCCTACCTCAG

TATCTGAAAAACCAACTTTATATGCCAATATAACTTTCTTGTTTATCATTGT
Translation
 - UNI22204 - MLCRLLLCECLLLITGYAHDDDWIDPTDMLNYDAASGTMRKSQ - UNI22204 - VRSGTSEKKEVSPDSSEAEELSDCLHRLD

SLTHK VDSCEKKKMKDYESQSNPVFRRYLNKILIEAGKLGL PDENKVEMRYDAEILLSRQTLLEIQKFLSGEEWKPGALDDALSDILINFKCHDSEAW

KWQFEDYFGVDPYNVFM VLLCLLCLVVLVATELWTYVRWYTQMKRIFIISFLLSLAWNWIYLYK MAFAQHQANIAGMEPFDNLCAKKMDWTGSLWE E

WFTSSWTYKDDPCQKYYELLIVNPIWLVPPTK ALAITFTNFVTEPLKHIGKGAGEFIKALMKEIPVLLQIPVLAILALAVL - UNI4329 - SFCYG

AGRSVPMLRHFGGPDREPPRALEPDDRRRQKGLDYRLHGGAGDADFSYRGPAGSIEQGPYDKMHASKRDALRQRFHSGNKSPEVLRAFDLPDTEAQEHPE

VVPS HKSPIMNTNLETGELPGESTPTEYSQSAKDVSGQVPSAGKSSPTVDKAQLKTDSECSPPGGCPPSKEAAVAAHGTEPVSSPCG
Transcript ENSMUST00000106610
Sequence
AGTCCGAGTGCACCGTGTTTGAGGTAGGCGGCTCGGCGTCTTCCGCGGCCGGGCTGGCCCGGGTCCCTCTGAAAGAGCAGGCAGGACCCTCGAC - UNI

22204 - GCCTTATTCAGGATGCTGTGTCGGCTGCTCCTTTGTGAATGTCTGTTGCTGATAACGGGTTATGCTCATGATGACGACTGGATTGACCCAAC

AGATATGCTTAACTATGACGCTGCTTCAGGAACGATGAGGAAATCTCAG - UNI22204 - GTGAGGTCTGGAACATCAGAGAAGAAGGAAGTGAGCC

CTGACTCGTCAGAAGCCGAGGAACTGTCAGACTGTTTGCACAGACTGGATTCTTTAACTCACAAG GTTGATAGTTGTGAAAAGAAGAAAATGAAAGATT

ATGAAAGTCAAAGTAATCCTGTTTTCAGGAGATATCTAAATAAGATTTTAATTGAAGCTGGCAAGCTTGGACTC CCTGATGAGAACAAAGTAGAGATGC

GTTACGATGCTGAGATTCTCCTGAGCAGACAGACACTGTTGGAGATTCAGAAGTTCCTCAGCGGAGAGGAGTGGAAGCCCGGAGCCCTGGACGACGCACT

AAGTGACATTTTAATCAATTTTAAGTGCCATGATTCAGAAGCATGGAAGTGGCAGTTTGAAGATTATTTTGGAGTAGATCCATATAATGTGTTTATG GT

TCTCTTGTGTCTGCTCTGCCTTGTGGTGCTGGTGGCTACAGAGCTGTGGACTTATGTTCGCTGGTACACACAGATGAAACGGATTTTCATCATCAGCTTT

CTCTTGAGTTTAGCATGGAATTGGATATATCTGTATAAG ATGGCTTTTGCTCAGCATCAGGCTAACATTGCTGGGATGGAGCCTTTCGACAATTTATGT

GCTAAGAAGATGGATTGGACTGGAAGTCTCTGGG AATGGTTTACAAGTTCATGGACCTATAAGGATGACCCATGCCAAAAGTACTATGAGCTCCTAATA

GTCAACCCTATTTGGTTGGTTCCACCAACAAAG GCTCTGGCGATTACATTCACTAACTTTGTAACGGAACCATTAAAGCACATTGGAAAAGGAGCAGGT

GAATTCATTAAAGCGCTCATGAAGGAGATTCCAGTGTTACTTCAGATTCCGGTGCTGGCGATCCTGGCGCTGGCTGTCCTG - UNI4329 - AGCTTC

TGCTATGGTGCTGGAAGGTCAGTTCCTATGCTGAGACACTTCGGTGGTCCTGACAGAGAACCTCCCCGAGCACTTGAGCCAGATGACAGAAGACGACAGA

AGGGACTTGACTATAGACTCCATGGTGGAGCAGGTGATGCAGATTTCTCTTACAGGGGCCCAGCTGGCTCCATCGAGCAAGGCCCTTATGACAAAATGCA

TGCGAGTAAGAGAGATGCTTTGAGACAGAGATTTCACTCTGGCAACAAGAGCCCTGAAGTGCTCCGGGCATTTGACTTACCTGACACAGAGGCACAAGAA

CATCCAGAAGTGGTCCCCAGC CATAAATCACCCATTATGAACACAAACCTTGAGACTGGTGAACTCCCAGGAGAAAGCACCCCGACAGAATACAGCCAG

TCTGCCAAGGATGTCTCTGGCCAAGTTCCCAGCGCTGGCAAAAGCTCACCCACAGTGGACAAGGCCCAGCTGAAGACAGACTCCGAGTGCAGCCCACCAG

GAGGCTGCCCACCCAGCAAGGAAGCTGCAGTGGCAGCACACGGGACTGAACCTGTCAGCAGCCCATGTGGCTAAAGAACAATGCACAGAGCAACCACAGC

TCCAGCCATCTTTGAA ATGCCCATTTGGGGATGGAATCTACCTTGACAGCTAGCAAAGCAACCTGCTGTTCTTGAGTGACTACAGCAATTCAGGGAAGA

CTTGATTAACACAGGTGACGATATCAAGGCCAGTTTATTGCAGAAAAGAGAAGCGGCTTGTCTCAAGTGATTAGTGTGACTATCTGAGGTTAAAGCACAT

TGTAACTGGCTTTTAAGAAAAGAACAGGGTAGGTAGTTGTTAAAGCACTTTTTAAAACAGAATAATTGTTGAATGCTTAACCATTGTAAACACAAAATAA

ACACTTATTTTT
Translation
 - UNI22204 - MLCRLLLCECLLLITGYAHDDDWIDPTDMLNYDAASGTMRKSQ - UNI22204 - VRSGTSEKKEVSPDSSEAEELSDCLHRLD

SLTHK VDSCEKKKMKDYESQSNPVFRRYLNKILIEAGKLGL PDENKVEMRYDAEILLSRQTLLEIQKFLSGEEWKPGALDDALSDILINFKCHDSEAW

KWQFEDYFGVDPYNVFM VLLCLLCLVVLVATELWTYVRWYTQMKRIFIISFLLSLAWNWIYLYK MAFAQHQANIAGMEPFDNLCAKKMDWTGSLWE E

WFTSSWTYKDDPCQKYYELLIVNPIWLVPPTK ALAITFTNFVTEPLKHIGKGAGEFIKALMKEIPVLLQIPVLAILALAVL - UNI4329 - SFCYG

AGRSVPMLRHFGGPDREPPRALEPDDRRRQKGLDYRLHGGAGDADFSYRGPAGSIEQGPYDKMHASKRDALRQRFHSGNKSPEVLRAFDLPDTEAQEHPE

VVPS HKSPIMNTNLETGELPGESTPTEYSQSAKDVSGQVPSAGKSSPTVDKAQLKTDSECSPPGGCPPSKEAAVAAHGTEPVSSPCG 
Transcript ENSMUST00000106611
Sequence
AGTCCGAGTGCACCGTGTTTGAGGTAGGCGGCTCGGCGTCTTCCGCGGCCGGGCTGGCCCGGGTCCCTCTGAAAGAGCAGGCAGGACCCTCGAC - UNI

22204 - GCCTTATTCAGGATGCTGTGTCGGCTGCTCCTTTGTGAATGTCTGTTGCTGATAACGGGTTATGCTCATGATGACGACTGGATTGACCCAAC

AGATATGCTTAACTATGACGCTGCTTCAGGAACGATGAGGAAATCTCAG - UNI22204 - GTGAGGTCTGGAACATCAGAGAAGAAGGAAGTGAGCC

CTGACTCGTCAGAAGCCGAGGAACTGTCAGACTGTTTGCACAGACTGGATTCTTTAACTCACAAG GTTGATAGTTGTGAAAAGAAGAAAATGAAAGATT

ATGAAAGTCAAAGTAATCCTGTTTTCAGGAGATATCTAAATAAGATTTTAATTGAAGCTGGCAAGCTTGGACTC CCTGATGAGAACAAAGTAGAGATGC

GTTACGATGCTGAGATTCTCCTGAGCAGACAGACACTGTTGGAGATTCAGAAGTTCCTCAGCGGAGAGGAGTGGAAGCCCGGAGCCCTGGACGACGCACT

AAGTGACATTTTAATCAATTTTAAGTGCCATGATTCAGAAGCATGGAAGTGGCAGTTTGAAGATTATTTTGGAGTAGATCCATATAATGTGTTTATG GT

TCTCTTGTGTCTGCTCTGCCTTGTGGTGCTGGTGGCTACAGAGCTGTGGACTTATGTTCGCTGGTACACACAGATGAAACGGATTTTCATCATCAGCTTT

CTCTTGAGTTTAGCATGGAATTGGATATATCTGTATAAG ATGGCTTTTGCTCAGCATCAGGCTAACATTGCTGGGATGGAGCCTTTCGACAATTTATGT

GCTAAGAAGATGGATTGGACTGGAAGTCTCTGGG AATGGTTTACAAGTTCATGGACCTATAAGGATGACCCATGCCAAAAGTACTATGAGCTCCTAATA

GTCAACCCTATTTGGTTGGTTCCACCAACAAAG GCTCTGGCGATTACATTCACTAACTTTGTAACGGAACCATTAAAGCACATTGGAAAAGGAGCAGGT

GAATTCATTAAAGCGCTCATGAAGGAGATTCCAGTGTTACTTCAGATTCCGGTGCTGGCGATCCTGGCGCTGGCTGTCCTG - UNI4329 - AGCTTC

TGCTATGGTGCTGGAAGGTCAGTTCCTATGCTGAGACACTTCGGTGGTCCTGACAGAGAACCTCCCCGAGCACTTGAGCCAGATGACAGAAGACGACAGA

AGGGACTTGACTATAGACTCCATGGTGGAGCAGGTGATGCAGATTTCTCTTACAGGGGCCCAGCTGGCTCCATCGAGCAAGGCCCTTATGACAAAATGCA

TGCGAGTAAGAGAGATGCTTTGAGACAGAGATTTCACTCTGGCAACAAGAGCCCTGAAGTGCTCCGGGCATTTGACTTACCTGACACAGAGGCACAAGAA

CATCCAGAAGTGGTCCCCAGC CATAAATCACCCATTATGAACACAAACCTTGAGACTGGTGAACTCCCAGGAGAAAGCACCCCGACAGAATACAGCCAG

TCTGCCAAGGATGTCTCTGGCCAAGTTCCCAGCGCTGGCAAAAGCTCACCCACAGTGGACAAGGCCCAGCTGAAGACAGACTCCGAGTGCAGCCCACCAG

GAGGCTGCCCACCCAGCAAGGAAGCTGCAGTGGCAGCACACGGGACTGAACCTGTCAGCAGCCCATGTGGCTAAAGAACAATGCACAGAGCAACCACAGC

TCCAGCCATCTTTGAA ATGCCCATTTGGGGATGGAATCTACCTTGACAGCTAGCAAAGCAACCTGCTGTTCTTGAGTGACTACAGCAATTCAGGGAAGA

CTTGATTAACACAGGTGACGATATCAAGGCCAGTTTATTGCAGAAAAGAGAAGCGGCTTGTCTCAAGTGATTAGTGTGACTATCTGAGGTTAAAGCACAT

TGTAACTGGCTTTTAAGAAAAGAACAGGGTAGGTAGTTGTTAAAGCACTTTTTAAAACAGAATAATTGTTGAATGCTTAACCATTGTAAACACAAAATAA

ACACTTATTTTT
Translation
 - UNI22204 - ALFRMLCRLLLCECLLLITGYAHDDDWIDPTDMLNYDAASGTMRKSQ - UNI22204 - VRSGTSEKKEVSPDSSEAEELSDCL

HRLDSLTHK VDSCEKKKMKDYESQSNPVFRRYLNKILIEAGKLGL PDENKVEMRYDAEILLSRQTLLEIQKFLSGEEWKPGALDDALSDILINFKCHD

SEAWKWQFEDYFGVDPYNVFM VLLCLLCLVVLVATELWTYVRWYTQMKRIFIISFLLSLAWNWIYLYK MAFAQHQANIAGMEPFDNLCAKKMDWTGSL

WE EWFTSSWTYKDDPCQKYYELLIVNPIWLVPPTK ALAITFTNFVTEPLKHIGKGAGEFIKALMKEIPVLLQIPVLAILALAVL - UNI4329 - S

FCYGAGRSVPMLRHFGGPDREPPRALEPDDRRRQKGLDYRLHGGAGDADFSYRGPAGSIEQGPYDKMHASKRDALRQRFHSGNKSPEVLRAFDLPDTEAQ

EHPEVVPS HKSPIMNTNLETGELPGESTPTEYSQSAKDVSGQVPSAGKSSPTVDKAQLKTDSECSPPGGCPPSKEAAVAAHGTEPVSSPCG 
Transcript ENSMUST00000106613
Sequence
TCGGCGTCTTCCGCGGCCGGGCTGGCCCGGGTCCCTCTGAAAGAGCAGGCAGGACCCTCGACGTGAGTGGGCGCTCTTCGGTGTGTCGGGGCGGCCCGCG

GGTCTGCGTGGGAGGCGGCGCGGCAGCGTGAGAGGTGCCGGGGCCTGGGCCCGTGGCGATTCCCTGTTCCGTCTTACGCGGGTAGACAGCGCCCGCCAGT

CATTCCCCTTGTCTCGGCTAACCCTGCGAATATACCGAGCGGCCCACCCTGGGGCAAGAGCATCCTTGCTTGTGTTATCTGAAACCTTGGCAGAATCTGC

AACAAATACTGACGGCCAAAAAATTATATATATATATTGGATTTGTTGGAGTAATG - UNI22204 - GCCTTATTCAGGATGCTGTGTCGGCTGCTC

CTTTGTGAATGTCTGTTGCTGATAACGGGTTATGCTCATGATGACGACTGGATTGACCCAACAGATATGCTTAACTATGACGCTGCTTCAGGAACGATGA

GGAAATCTCAG - UNI22204 - GTGAGGTCTGGAACATCAGAGAAGAAGGAAGTGAGCCCTGACTCGTCAGAAGCCGAGGAACTGTCAGACTGTTTG

CACAGACTGGATTCTTTAACTCACAAG GTTGATAGTTGTGAAAAGAAGAAAATGAAAGATTATGAAAGTCAAAGTAATCCTGTTTTCAGGAGATATCTA

AATAAGATTTTAATTGAAGCTGGCAAGCTTGGACTC CCTGATGAGAACAAAGTAGAGATGCGTTACGATGCTGAGATTCTCCTGAGCAGACAGACACTG

TTGGAGATTCAGAAGTTCCTCAGCGGAGAGGAGTGGAAGCCCGGAGCCCTGGACGACGCACTAAGTGACATTTTAATCAATTTTAAGTGCCATGATTCAG

AAGCATGGAAGTGGCAGTTTGAAGATTATTTTGGAGTAGATCCATATAATGTGTTTATG GTTCTCTTGTGTCTGCTCTGCCTTGTGGTGCTGGTGGCTA

CAGAGCTGTGGACTTATGTTCGCTGGTACACACAGATGAAACGGATTTTCATCATCAGCTTTCTCTTGAGTTTAGCATGGAATTGGATATATCTGTATAA

G ATGGCTTTTGCTCAGCATCAGGCTAACATTGCTGGGATGGAGCCTTTCGACAATTTATGTGCTAAGAAGATGGATTGGACTGGAAGTCTCTGGG AAT

GGTTTACAAGTTCATGGACCTATAAGGATGACCCATGCCAAAAGTACTATGAGCTCCTAATAGTCAACCCTATTTGGTTGGTTCCACCAACAAAG GCTC

TGGCGATTACATTCACTAACTTTGTAACGGAACCATTAAAGCACATTGGAAAAGGAGCAGGTGAATTCATTAAAGCGCTCATGAAGGAGATTCCAGTGTT

ACTTCAGATTCCGGTGCTGGCGATCCTGGCGCTGGCTGTCCTG - UNI4329 - AGCTTCTGCTATGGTGCTGGAAGGTCAGTTCCTATGCTGAGACA

CTTCGGTGGTCCTGACAGAGAACCTCCCCGAGCACTTGAGCCAGATGACAGAAGACGACAGAAGGGACTTGACTATAGACTCCATGGTGGAGCAGGTGAT

GCAGATTTCTCTTACAGGGGCCCAGCTGGCTCCATCGAGCAAGGCCCTTATGACAAAATGCATGCGAGTAAGAGAGATGCTTTGAGACAGAGATTTCACT

CTGGCAACAAGAGCCCTGAAGTGCTCCGGGCATTTGACTTACCTGACACAGAGGCACAAGAACATCCAGAAGTGGTCCCCAGC CATAAATCACCCATTA

TGAACACAAACCTTGAGACTGGTGAACTCCCAGGAGAAAGCACCCCGACAGAATACAGCCAGTCTGCCAAGGATGTCTCTGGCCAAGTTCCCAGCGCTGG

CAAAAGCTCACCCACAGTGGACAAGGCCCAGCTGAAGACAGACTCCGAGTGCAGCCCACCAGGAGGCTGCCCACCCAGCAAGGAAGCTGCAGTGGCAGCA

CACGGGACTGAACCTGTCAGCAGCCCATGTGGCTAAAGAACAATGCACAGAGCAACCACAGCTCCAGCCATCTTTGAAGTCTGTATTGACTCTTCATCCT

TCCTTACAAATTTACTACAAAGCTGCCAACTTTAAATTAGTAATTTTACAGACCATCAGAGTACCTCTTAGCTGTTAGGATATAGCTCATATTTTAGAAC

AAGGTTTTATAAAATTTACATTTTTAAGTTACTGCTTTAGCAGATAGACACCATTAAGTGAGCTGATACTATCAGGCGTTTAACTAACATTAAATGTTTC

TTTGGCTACACTGCTACATGACAGCTAGCAAAGCAGGAGCCAACTGATCAAAGTGTGTTGGCTGACAGAAGTCCTCTGAAACCTAGTTTACTAACAGGGT

ATTTAATGCAGGCTGGGTCTGCTGCTGCCACAGAGTCAGGCACCTGTGTTTTTATGTAGGCTACCTGCAGAACGACGTGACTTTCTGGTTATGGGGCCTG

TCTCCTTGTCATCCATTCTACATTAGGTCTTACTAAGACAAGCCTGGATGGTCTGGTTCTAGCGATACTTGAGTTTCACACTTTGTCAGTGACTGTGGGA

ATGGCTTTATTCTCTACCATGTAGTACCAGATTTAGAAAGCCCCATTTTCATGTTTGGAATCGTGCAGTTGCTTTGATGCTATTCAGTTTACTATACTGT

CTTGGCTAAATGTAATTCTGGTTTTCAGAGAGGTGTAGATAGAGAACAAGATGTATTAACATTTTTGAGTCAACATTATGTTGGTGATTTTAAAGTGCAT

TCTCCATTTTATACCTTTAAAAAAGCAATTTATGTATTTTGTACACGTCCTAGCTAGCACTCTTTCTGTGCACGCAGGTGTCCTTTGTTGTTGCAACCAT

ATCTACACTGCACATTTTATTCAGATGAGACCGCTCAAGAATTAAGTCTTGAAATTAATTACCAGGCAGGCTGCTTCAACAAGGACATTTTGTCTGAACA

GTTGATTTTTGATTTCTTTCTACAAATGTGTGATCCTCCTTTTTTTTCCTACCTCAGTATCTGAAAAACCAACTTTATATGCCAATATAACTTTCTTGTT

TATCATTGTAAA
Translation
M - UNI22204 - ALFRMLCRLLLCECLLLITGYAHDDDWIDPTDMLNYDAASGTMRKSQ - UNI22204 - VRSGTSEKKEVSPDSSEAEELSDC

LHRLDSLTHK VDSCEKKKMKDYESQSNPVFRRYLNKILIEAGKLGL PDENKVEMRYDAEILLSRQTLLEIQKFLSGEEWKPGALDDALSDILINFKCH

DSEAWKWQFEDYFGVDPYNVFM VLLCLLCLVVLVATELWTYVRWYTQMKRIFIISFLLSLAWNWIYLYK MAFAQHQANIAGMEPFDNLCAKKMDWTGS

LWE EWFTSSWTYKDDPCQKYYELLIVNPIWLVPPTK ALAITFTNFVTEPLKHIGKGAGEFIKALMKEIPVLLQIPVLAILALAVL - UNI4329 - 

SFCYGAGRSVPMLRHFGGPDREPPRALEPDDRRRQKGLDYRLHGGAGDADFSYRGPAGSIEQGPYDKMHASKRDALRQRFHSGNKSPEVLRAFDLPDTEA

QEHPEVVPS HKSPIMNTNLETGELPGESTPTEYSQSAKDVSGQVPSAGKSSPTVDKAQLKTDSECSPPGGCPPSKEAAVAAHGTEPVSSPCG

For any suggestions or comments, please send an email to unitrap@crg.es