Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027933 (Ints3)
Chromosomal location
Chr 3: 90195310 - 90237558 (-)
Description
integrator complex subunit 3 Gene [Source:MGI Symbol;Acc:MGI:2140050]
RefSeq_dna
NM_145540 NM_178876 
RefSeq_peptide
NP_663515.2 NP_849207.2 
UniGene
Mm.268564 
MGI
MGI:2140050 
Uniprot/SWISSPROT
Q7TPD0 
Uniprot/SPTREMBL
A0A4X0 A0A4X3 
Human Ortholog
ENSG00000143624 (INTS3)
Omim not available
UniTrap UNI6642
Vector Insertion
Chr 3: 90228010 - 90236725
Public Clones (sanger) RHA269 (baygenomics) RRT152 (baygenomics) D074E12 (ggtc)
IST11517G2HMF2 (tigm) IST12866D10 (tigm) IST11517G2 (tigm)
Private Clones OST449094 (lexicon) OST432950 (lexicon) OST274133 (lexicon) OST251742 (lexicon)
OST221199 (lexicon) OST163451 (lexicon) OST140904 (lexicon) OST35297 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7332
Vector Insertion
Chr 3: 90225742 - 90227925
Public Clones RRU067 (baygenomics)
Private Clones OST239640 (lexicon) OST226167 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22501
Vector Insertion
Chr 3: 90219529 - 90225657
Public Clones (ggtc) IST12315C3 (tigm)
Private Clones OST295216 (lexicon) OST57899 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23835
Vector Insertion
Chr 3: 90219165 - 90219414
Public Clones not available
Private Clones OST242977 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22280
Vector Insertion
Chr 3: 90215268 - 90217451
Public Clones not available
Private Clones OST301705 (lexicon) OST297585 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9749
Vector Insertion
Chr 3: 90207987 - 90208435
Public Clones XG316 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1872
Vector Insertion
Chr 3: 90207520 - 90207906
Public Clones AZ0168 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5945
Vector Insertion
Chr 3: 90197717 - 90197995
Public Clones CSH268 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20352
Vector Insertion
Chr 3: 90196028 - 90196133
Public Clones not available
Private Clones OST366171 (lexicon)
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000071488
Sequence
ATTGGCAGCCCGGGAAAAGGCCAGTCCGCCGTCGTCGGCTTACTCCTTAGAGACCTGGCGCCACCGCGGAAGCCGCTATTGGCGGACGCCCGGGACCGCG

ACTGCTCACTTCCGGCGCCGGCGACGACTCTGCCCGCTCGGGCACTCTCAGCCTCCCCCGCCCTTCCACCATGGCCGCCTCTGTGTGGTGTGGGGAGAAG

CTGGTCCTCCCATAGCGCTCCTGCTGCATCCTCACCCGCTAGGGGCCGGATTCCAAGGAACCGCGTTTCCCAATCCCGCCGGGAAGGTTTCCCACTCCCA

ATTCAGGGCCAGGACTCCTTCCCACGCCTCGAGAGGCAGAAACTTAGGGTTTCCCCTCCTTTCAGGATAAGAAGCCAGAGGGTTTCCCCCTCCACTTCTG

CAAGGGTGGCAGCCTTGCCTATCTCCCTGCAGGACACAAGACCCTTAGTCTACCATACTTCTGCGCAAAAGCTTTGCCCCAGCCCGGCCACTCCTGAGGG

AGCATCTAGAGAACCCGCGCCTTCCCCCTCCGCAGGAGAGGAGGCAAGAGTGCGGAAAGCCAGGCCTGTCGGCCTCCCTCCCACTTGTTCCTCTTGCTCC

TCGTCCTTGGCAAGCCAGAGTTCTCCATTTCTAGGACTTAACACCCGTCTACTCCCTTGACCTCTTCTGGTCTCTTGGCTGCAGCCATGGAGTTACAGAA

GGGAAAGGGGACCGTAGCAGCTGCTGCATCAGGAGCAGCGGGAGGTGGAGGAGGAGGAGCGGGAGCAGGAGCCCCAGGAGGGGGGAGGCTGCTACTTTCA

ACCAGTTTGGATGCCAAGGATGAGTTAGAGGAG - UNI6642 - AGGTTGGAAAGGTGCATGAGTATTGTCACATCGATGACCGCTGGTGTCTCCGAG

AGAGAGGCCAATGATGCTCTCAATGCCTAT - UNI7332 - GTGTGCAAAGGACCTCCCCAGCATGAGGAGATCTGCCTAGGCCTGTTTACTCTTGTC

CTCACTGAGCCTGCCCAAGCCCAGAAG - UNI22501 - TGTTACCGGGACTTGGCTCTGGTGAGTCGTGATGGTATGAACATCGTCCTGAACAAGAT

CAACCAGCTACTTATGGAGAAGTACTTGAAGCTGCAAGATACCTGCCGTACTCAG - UNI23835 - TTGGTGTGGTTGGTTCGGGAACTAGTAAAGA

GTGGAGTTCTGGGAGCTGATGGCGTTTGCATGACATTTATGAAGCAGATTGCAG GTGGCGATGTTACAGCCAAAAATATCTGGTTGGCAGAAAGTGTCC

TGGATATCCTGACGGAGCAGAG - UNI22280 - GGAGTGGGTGCTGAAGAGCAGCATCCTCATTGCCATGGCTGTGTACACGTACCTCCGACTTATT

GTGGACCACCATGGGACTGCCCAGCTCCAGACCCTTCGGCAGAAGGAAGTTGACTTCTGCATCTCCTTGCTTCGGGAACGG TTCATGGAATGTTTGATG

ATTGGCCGGGACCTTGTAAGATTACTTCAGAATGTTGCTAGGATACCAGAATTTGAACTACTGTGGAAAGATATCATCCATAACCCTCAGGCCTTGAGTC

CTCAGTTTACAG GTATCCTACAGCTACTTCAGTCAAGAACATCCCGAAAATTTCTAGCCTGTCGTCTAACCCCAGACATGGAAACGAAGCTCCTCTTCA

TGACATCCCGG GTGCGGTTTGGCCAGCAAAAGCGGTACCAGGACTGGTTCCAGCGCCAGTACCTCTCAACCCCTGACAGTCAGTCTCTGCGCTGTGACC

TCATTCGATACATCTGTGGGGTAGTCCACCCCTCTAACGAAGTGCTGAGTTCTGATATCTTGCCCCGGTGGGCCATCATTGGCTGGCTCCTGACAACATG

CACG TCCAACGTTGCTGCCTCCAATGCCAAGCTGGCTTTGTTTTATGACTGGCTGTTCTTCAGCCCAGAAAAGGATAGTATTATGAACATAG - UNI9

749 - AGCCAGCTATCCTGGTCATGCATCACTCCATGAAGCCCCACCCAGCCATCACTGCCACGCTCCTGGACTTCATGTGCCGA - UNI1872 - A

TCATTCCTAACTTCTACCCACCATTGGAAGGCCACGTTCGGCAGGGTGTCTTTTCTTCCCTCAACCACATTGTGGAGAAACGAGTCTTGGC ACACTTGG

CTCCCCTGTTTGACAACCCTAAATTGGATAAAGAGCTTCGGTCCATGCTTCGGGAGAAGTTTCCTGAGTTCTGCAGCTCGCCCTCCCCTCCTGTGGAAG 

TCAAAATTGAAGAGCCTGTTTCCATGGAAATGGACAACCACCTCTCAGATAAGGATGAGAGTTGCTATGACAATGCAGAGGCAGCCTTCAGTGATGATGA

GGAGGATCTTAATAGCAAAG GGAAGAAGAGAGAGTTTCGCTTCCACCCCATCAAGGAGACTGTCGTGGAGGAGCCGGTTGATGTCACCCCTTACCTTGA

TCAGTTGGACGAGTCCCTGAGGGACAAAGTGCTACAGCTACAGAAGGGAAG TGATACAGAGGCCCAGTGTGAGGTTATGCAGGAAATTGTGGATCAGGT

CCTGGAG GAAGACTTTGACTCGGAGCAACTGTCTGTCCTGGCTTCCTGCCTACAGGAGCTCTTCAAGGCCCACTTTCGAGGGGAGGTGTTGCCTGAAGA

GGTCACTGAAGA GTCCCTGGAGGAGTCAGTAGGGAAACCACTGTACCTAATATTTAG GAACCTGTGCCAGATGCAGGAGGACAACAGCAGCTTCTCGC

TGCTTCTGGACCTTCTCTCCGAGCTGTATCAAAAGCAACCCAAGATCGGCTACCACCTGCTCTACTACTTGAGGGCAAG CAAAGCCGCCGCAGGGAAGA

TGAACCTGTATGAGTCGTTTGCCCAGGCTACCCAGCTGGGTGATCTGCACACCTGTCTAATGATGGACATGAAGGCCTGCCAAGAGGATGATGTGCGACT

GCTATGCCACCTCACACCTTCCATCTACACAGAG TTTCCAGATGAAACTTTGAGGAGTGGGGAGCTGCTGAACATGATTGTGGCTGTTATTGACTCTGC

ACAG CTCCAGGAGCTGGTCTGCCATGTGATGATGGGGAACCTGGTCATGTTTCGGAAGGACTCAGTCCTCAACATACTCA TTCAGAGCCTAGACTGGG

AAACGTTTGAGCAGTACTGTGCCTGGCAGCTCTTCCTGGCCCACAACATCCCCTTGGAGACCATTATTCCTATTCTCCAGCACCTCAAATACAAGG - U

NI5945 - AGCACCCAGAGGCCCTGTCCTGTCTCCTGCTTCAGCTACGGAGAGAGAA GCCGAGTGAGGAGATGGTGAAGATGGTGCTGAGCAGGCCCT

GCCATCCTGATGACCAGTTCACCACCAGCATCCTGAGGCACTGGTGCATGAAGCACGACGAGCTGCTGGCAGAGCACATCAAGGCGCTGCTCATCAAGAA

CAACAGCCTGCCCCGCAAGAGGCAGAG CCTAAGAAGCTCTAGCAGCAAGCTGGCCCAGCTGACCCTGGAACAGATCCTGGAACACTTGGACAACCTAAG

GCTCAACCTAGCCAACACCAAGCAGAACT TCTTTAGCCAGACACCAATCCTCCAGGCGCTGCAGCATGTCCAGGCAAGCTGTGACGAAGCTCACAAGAT

GAA GTTCAGTGACCTCTTCTCCCTGGCGGAGGAATATGAGGACTCTTCCACTAAGCCACCCAAGAGCCGGCGGAAGGCAGCTCTGTCCAGCCCTCGAAG

TCGAAAGAATGCTACCCAGCCCCCCAATGCTGAAGAGGAGTCAGGCTCCAGCAGTGCCTCG - UNI20352 - GAGGAAGAAGATACAAAGCCTAAGC

CTACCAAACGAAAACGAAAAGGCTCCTCTGCTGTGGGTTCTGACAGTGACTGAGGCCTGGATCCCCACCCTGCCCCAGCCTGAGAAAG GTTCTCACAGC

AACCAGAAGCTGTGCAGAAGCAGATCATGGTGGAAGTCCTTTGCCGCCGGCTCCTCCCCAAGTCTCCGAAGAGCCATTTGGACAGAGAAAGGAGTGATGA

AGAGGCTGCTGGGCAGAGGAGCTGGGGTGACAGCAGATGCTGTGTGAGTGGGCATTTCCCCCTGCTTCCTGTCAGTCTGCATTTGTAGTCTGTGGACGGT

GGTCATTACACCAGTGTGAAGTGGGCATCTGACCTGGTGTGGGCGGTGCCCATCTGGGCAGATGCCACAGCCTTCAGAAAAGAACCCAATGGCAGCGTGA

GAGGCTCTTGCTGCACCTGGGATGCTTGGGTTGGCCCGGCATTGGCACTTCAAGCTGAGCCAGAGCCCAGGGGAGTCCTGGAGGCAAGTTCCTCAGAACT

GTCAGATGGCCTGATTTTCTGTGGTTCTGTTTTTGCTTTTTCTTTTGGCAAAGATAATCGAGTTTTAAATTGTTTTTAAGTGATAATGAAACAAGCCAGA

ACATCTTTTGTGC
Translation
MELQKGKGTVAAAASGAAGGGGGGAGAGAPGGGRLLLSTSLDAKDELEE - UNI6642 - RLERCMSIVTSMTAGVSEREANDALNAY - UNI7332

 - VCKGPPQHEEICLGLFTLVLTEPAQAQK - UNI22501 - CYRDLALVSRDGMNIVLNKINQLLMEKYLKLQDTCRTQ - UNI23835 - LVW

LVRELVKSGVLGADGVCMTFMKQIAG GGDVTAKNIWLAESVLDILTEQR - UNI22280 - REWVLKSSILIAMAVYTYLRLIVDHHGTAQLQTLRQ

KEVDFCISLLRER FMECLMIGRDLVRLLQNVARIPEFELLWKDIIHNPQALSPQFTG GILQLLQSRTSRKFLACRLTPDMETKLLFMTSR VRFGQQK

RYQDWFQRQYLSTPDSQSLRCDLIRYICGVVHPSNEVLSSDILPRWAIIGWLLTTCT SNVAASNAKLALFYDWLFFSPEKDSIMNIE - UNI9749 -

 EPAILVMHHSMKPHPAITATLLDFMCR - UNI1872 - IIPNFYPPLEGHVRQGVFSSLNHIVEKRVLA AHLAPLFDNPKLDKELRSMLREKFPEF

CSSPSPPVEV VKIEEPVSMEMDNHLSDKDESCYDNAEAAFSDDEEDLNSKG GKKREFRFHPIKETVVEEPVDVTPYLDQLDESLRDKVLQLQKGS SD

TEAQCEVMQEIVDQVLE EDFDSEQLSVLASCLQELFKAHFRGEVLPEEVTEE ESLEESVGKPLYLIFR RNLCQMQEDNSSFSLLLDLLSELYQKQPK

IGYHLLYYLRAS SKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTE FPDETLRSGELLNMIVAVIDSAQ LQELVCHVMM

GNLVMFRKDSVLNILI IQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKE - UNI5945 - EHPEALSCLLLQLRREK KPSEEMVKMVLSR

PCHPDDQFTTSILRHWCMKHDELLAEHIKALLIKNNSLPRKRQS SLRSSSSKLAQLTLEQILEHLDNLRLNLANTKQNF FFSQTPILQALQHVQASCD

EAHKMK KFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQPPNAEEESGSSSAS - UNI20352 - EEEDTKPKPTKRKRKGSSAVGSDSD 

Transcript ENSMUST00000029542
Sequence
ATTGGCAGCCCGGGAAAAGGCCAGTCCGCCGTCGTCGGCTTACTCCTTAGAGACCTGGCGCCACCGCGGAAGCCGCTATTGGCGGACGCCCGGGACCGCG

ACTGCTCACTTCCGGCGCCGGCGACGACTCTGCCCGCTCGGGCACTCTCAGCCTCCCCCGCCCTTCCACCATGGCCGCCTCTGTGTGGTGTGGGGAGAAG

CTGGTCCTCCCATAGCGCTCCTGCTGCATCCTCACCCGCTAGGGGCCGGATTCCAAGGAACCGCGTTTCCCAATCCCGCCGGGAAGGTTTCCCACTCCCA

ATTCAGGGCCAGGACTCCTTCCCACGCCTCGAGAGGCAGAAACTTAGGGTTTCCCCTCCTTTCAGGATAAGAAGCCAGAGGGTTTCCCCCTCCACTTCTG

CAAGGGTGGCAGCCTTGCCTATCTCCCTGCAGGACACAAGACCCTTAGTCTACCATACTTCTGCGCAAAAGCTTTGCCCCAGCCCGGCCACTCCTGAGGG

AGCATCTAGAGAACCCGCGCCTTCCCCCTCCGCAGGAGAGGAGGCAAGAGTGCGGAAAGCCAGGCCTGTCGGCCTCCCTCCCACTTGTTCCTCTTGCTCC

TCGTCCTTGGCAAGCCAGAGTTCTCCATTTCTAGGACTTAACACCCGTCTACTCCCTTGACCTCTTCTGGTCTCTTGGCTGCAGCCATGGAGTTACAGAA

GGGAAAGGGGACCGTAGCAGCTGCTGCATCAGGAGCAGCGGGAGGTGGAGGAGGAGGAGCGGGAGCAGGAGCCCCAGGAGGGGGGAGGCTGCTACTTTCA

ACCAGTTTGGATGCCAAGGATGAGTTAGAGGAG - UNI6642 - AGGTTGGAAAGGTGCATGAGTATTGTCACATCGATGACCGCTGGTGTCTCCGAG

AGAGAGGCCAATGATGCTCTCAATGCCTAT - UNI7332 - GTGTGCAAAGGACCTCCCCAGCATGAGGAGATCTGCCTAGGCCTGTTTACTCTTGTC

CTCACTGAGCCTGCCCAAGCCCAGAAG - UNI22501 - TGTTACCGGGACTTGGCTCTGGTGAGTCGTGATGGTATGAACATCGTCCTGAACAAGAT

CAACCAGCTACTTATGGAGAAGTACTTGAAGCTGCAAGATACCTGCCGTACTCAG - UNI23835 - TTGGTGTGGTTGGTTCGGGAACTAGTAAAGA

GTGGAGTTCTGGGAGCTGATGGCGTTTGCATGACATTTATGAAGCAGATTGCAG GTGGCGATGTTACAGCCAAAAATATCTGGTTGGCAGAAAGTGTCC

TGGATATCCTGACGGAGCAGAG - UNI22280 - GGAGTGGGTGCTGAAGAGCAGCATCCTCATTGCCATGGCTGTGTACACGTACCTCCGACTTATT

GTGGACCACCATGGGACTGCCCAGCTCCAGACCCTTCGGCAGAAGGAAGTTGACTTCTGCATCTCCTTGCTTCGGGAACGG TTCATGGAATGTTTGATG

ATTGGCCGGGACCTTGTAAGATTACTTCAGAATGTTGCTAGGATACCAGAATTTGAACTACTGTGGAAAGATATCATCCATAACCCTCAGGCCTTGAGTC

CTCAGTTTACAG GTATCCTACAGCTACTTCAGTCAAGAACATCCCGAAAATTTCTAGCCTGTCGTCTAACCCCAGACATGGAAACGAAGCTCCTCTTCA

TGACATCCCGG GTGCGGTTTGGCCAGCAAAAGCGGTACCAGGACTGGTTCCAGCGCCAGTACCTCTCAACCCCTGACAGTCAGTCTCTGCGCTGTGACC

TCATTCGATACATCTGTGGGGTAGTCCACCCCTCTAACGAAGTGCTGAGTTCTGATATCTTGCCCCGGTGGGCCATCATTGGCTGGCTCCTGACAACATG

CACG TCCAACGTTGCTGCCTCCAATGCCAAGCTGGCTTTGTTTTATGACTGGCTGTTCTTCAGCCCAGAAAAGGATAGTATTATGAACATAG - UNI9

749 - AGCCAGCTATCCTGGTCATGCATCACTCCATGAAGCCCCACCCAGCCATCACTGCCACGCTCCTGGACTTCATGTGCCGA - UNI1872 - A

TCATTCCTAACTTCTACCCACCATTGGAAGGCCACGTTCGGCAGGGTGTCTTTTCTTCCCTCAACCACATTGTGGAGAAACGAGTCTTGGC ACACTTGG

CTCCCCTGTTTGACAACCCTAAATTGGATAAAGAGCTTCGGTCCATGCTTCGGGAGAAGTTTCCTGAGTTCTGCAGCTCGCCCTCCCCTCCTGTGGAAG 

TCAAAATTGAAGAGCCTGTTTCCATGGAAATGGACAACCACCTCTCAGATAAGGATGAGAGTTGCTATGACAATGCAGAGGCAGCCTTCAGTGATGATGA

GGAGGATCTTAATAGCAAAG GGAAGAAGAGAGAGTTTCGCTTCCACCCCATCAAGGAGACTGTCGTGGAGGAGCCGGTTGATGTCACCCCTTACCTTGA

TCAGTTGGACGAGTCCCTGAGGGACAAAGTGCTACAGCTACAGAAGGGAAG TGATACAGAGGCCCAGTGTGAGGTTATGCAGGAAATTGTGGATCAGGT

CCTGGAG GAAGACTTTGACTCGGAGCAACTGTCTGTCCTGGCTTCCTGCCTACAGGAGCTCTTCAAGGCCCACTTTCGAGGGGAGGTGTTGCCTGAAGA

GGTCACTGAAGA GTCCCTGGAGGAGTCAGTAGGGAAACCACTGTACCTAATATTTAG GAACCTGTGCCAGATGCAGGAGGACAACAGCAGCTTCTCGC

TGCTTCTGGACCTTCTCTCCGAGCTGTATCAAAAGCAACCCAAGATCGGCTACCACCTGCTCTACTACTTGAGGGCAAG CAAAGCCGCCGCAGGGAAGA

TGAACCTGTATGAGTCGTTTGCCCAGGCTACCCAGCTGGGTGATCTGCACACCTGTCTAATGATGGACATGAAGGCCTGCCAAGAGGATGATGTGCGACT

GCTATGCCACCTCACACCTTCCATCTACACAGAG TTTCCAGATGAAACTTTGAGGAGTGGGGAGCTGCTGAACATGATTGTGGCTGTTATTGACTCTGC

ACAG CTCCAGGAGCTGGTCTGCCATGTGATGATGGGGAACCTGGTCATGTTTCGGAAGGACTCAGTCCTCAACATACTCA TTCAGAGCCTAGACTGGG

AAACGTTTGAGCAGTACTGTGCCTGGCAGCTCTTCCTGGCCCACAACATCCCCTTGGAGACCATTATTCCTATTCTCCAGCACCTCAAATACAAGG - U

NI5945 - AGCACCCAGAGGCCCTGTCCTGTCTCCTGCTTCAGCTACGGAGAGAGAA GCCGAGTGAGGAGATGGTGAAGATGGTGCTGAGCAGGCCCT

GCCATCCTGATGACCAGTTCACCACCAGCATCCTGAGGCACTGGTGCATGAAGCACGACGAGCTGCTGGCAGAGCACATCAAGGCGCTGCTCATCAAGAA

CAACAGCCTGCCCCGCAAGAGGCAGAG CCTAAGAAGCTCTAGCAGCAAGCTGGCCCAGCTGACCCTGGAACAGATCCTGGAACACTTGGACAACCTAAG

GCTCAACCTAGCCAACACCAAGCAGAACT TCTTTAGCCAGACACCAATCCTCCAGGCGCTGCAGCATGTCCAGGCAAGCTGTGACGAAGCTCACAAGAT

GAA GTTCAGTGACCTCTTCTCCCTGGCGGAGGAATATGAGGACTCTTCCACTAAGCCACCCAAGAGCCGGCGGAAGGCAGCTCTGTCCAGCCCTCGAAG

TCGAAAGAATGCTACCCAGCCCCCCAATGCTGAAGAGGAGTCAGGCTCCAGCAGTGCCTCG - UNI20352 - GAGGAAGAAGATACAAAGCCTAAGC

CTACCAAACGAAAACGAAAAGGCTCCTCTGCTGTGGGTTCTGACAGTGACTGAGGCCTGGATCCCCACCCTGCCCCAGCCTGAGAAAGGTCCATGCAGCC

CCACCTCTCCTCTCCTCCCAGGGCCTCCAGCTCTTTTCACCCCCTCTTCACTGCTGCTCCCACTGGTAGGTTCTCACAGCAACCAGAAGCTGTGCAGAAG

CAGATCATGGTGGAAGTCCTTTGCCGCCGGCTCCTCCCCAAGTCTCCGAAGAGCCATTTGGACAGAGAAAGGAGTGATGAAGAGGCTGCTGGGCAGAGGA

GCTGGGGTGACAGCAGATGCTGTGTGAGTGGGCATTTCCCCCTGCTTCCTGTCAGTCTGCATTTGTAGTCTGTGGACGGTGGTCATTACACCAGTGTGAA

GTGGGCATCTGACCTGGTGTGGGCGGTGCCCATCTGGGCAGATGCCACAGCCTTCAGAAAAGAACCCAATGGCAGCGTGAGAGGCTCTTGCTGCACCTGG

GATGCTTGGGTTGGCCCGGCATTGGCACTTCAAGCTGAGCCAGAGCCCAGGGGAGTCCTGGAGGCAAGTTCCTCAGAACTGTCAGATGGCCTGATTTTCT

GTGGTTCTGTTTTTGCTTTTTCTTTTGGCAAAGATAATCGAGTTTTAAATTGTTTTTAAGTGATAATGAAACAAGCCAGAACATCTTTTGTGC
Translation
MELQKGKGTVAAAASGAAGGGGGGAGAGAPGGGRLLLSTSLDAKDELEE - UNI6642 - RLERCMSIVTSMTAGVSEREANDALNAY - UNI7332

 - VCKGPPQHEEICLGLFTLVLTEPAQAQK - UNI22501 - CYRDLALVSRDGMNIVLNKINQLLMEKYLKLQDTCRTQ - UNI23835 - LVW

LVRELVKSGVLGADGVCMTFMKQIAG GGDVTAKNIWLAESVLDILTEQR - UNI22280 - REWVLKSSILIAMAVYTYLRLIVDHHGTAQLQTLRQ

KEVDFCISLLRER FMECLMIGRDLVRLLQNVARIPEFELLWKDIIHNPQALSPQFTG GILQLLQSRTSRKFLACRLTPDMETKLLFMTSR VRFGQQK

RYQDWFQRQYLSTPDSQSLRCDLIRYICGVVHPSNEVLSSDILPRWAIIGWLLTTCT SNVAASNAKLALFYDWLFFSPEKDSIMNIE - UNI9749 -

 EPAILVMHHSMKPHPAITATLLDFMCR - UNI1872 - IIPNFYPPLEGHVRQGVFSSLNHIVEKRVLA AHLAPLFDNPKLDKELRSMLREKFPEF

CSSPSPPVEV VKIEEPVSMEMDNHLSDKDESCYDNAEAAFSDDEEDLNSKG GKKREFRFHPIKETVVEEPVDVTPYLDQLDESLRDKVLQLQKGS SD

TEAQCEVMQEIVDQVLE EDFDSEQLSVLASCLQELFKAHFRGEVLPEEVTEE ESLEESVGKPLYLIFR RNLCQMQEDNSSFSLLLDLLSELYQKQPK

IGYHLLYYLRAS SKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTE FPDETLRSGELLNMIVAVIDSAQ LQELVCHVMM

GNLVMFRKDSVLNILI IQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKE - UNI5945 - EHPEALSCLLLQLRREK KPSEEMVKMVLSR

PCHPDDQFTTSILRHWCMKHDELLAEHIKALLIKNNSLPRKRQS SLRSSSSKLAQLTLEQILEHLDNLRLNLANTKQNF FFSQTPILQALQHVQASCD

EAHKMK KFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQPPNAEEESGSSSAS - UNI20352 - EEEDTKPKPTKRKRKGSSAVGSDSD

For any suggestions or comments, please send an email to unitrap@crg.es