Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027947 (Il6ra)
Chromosomal location
Chr 3: 89674041 - 89717081 (-)
Description
interleukin 6 receptor, alpha Gene [Source:MGI Symbol;Acc:MGI:105304]
RefSeq_dna
NM_010559 
RefSeq_peptide
NP_034689.2 
UniGene
Mm.2856 
MGI
MGI:105304 
Uniprot/SWISSPROT
P22272 
Uniprot/SPTREMBL
Q3URV7 
Human Ortholog
ENSG00000160712 (IL6R)
Omim not available
UniTrap UNI20749
Vector Insertion
Chr 3: 89694396 - 89716876
Public Clones CMHD-GT_379H7-3 (cmhd) (cmhd) IST14176D5 (tigm) IST10204H3 (tigm)
Private Clones OST353131 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029559
Sequence
GTGCGAGCTGAGTGTGGAGCCCGAGGCCGAGGGCGACTGCTCTCGCTGCCCCAGTCTGCCGGCCGCCCGGCCCCGGCTGCGGAGCCGCTCTGCCGCCCGC

CGTCCCGCGTAGAAGGAAGCATGCTGACCGTCGGCTGCACGCTGTTGGTCGCCCTGCTGGCCGCGCCCGCGGTCGCGCTGGTCCTCGGGAGCTGCCGCGC

GCTGG - UNI20749 - AGGTGGCAAATGGCACAGTGACAAGCCTGCCAGGGGCCACCGTTACCCTGATTTGCCCCGGGAAGGAAGCAGCAGGCAATG

TTACCATTCACTGGGTGTACTCTGGCTCACAAAACAGAGAATGGACTACCACAGGAAACACACTGGTTCTGAGGGACGTGCAGCTCAGCGACACTGGGGA

CTATTTATGCTCCCTGAATGATCACCTGGTGGGGACTGTGCCCTTGCTGGTGGATG TTCCCCCAGAGGAGCCCAAGCTCTCCTGCTTCCGGAAGAACCC

CCTTGTCAACGCCATCTGTGAGTGGCGTCCGAGCAGCACCCCCTCTCCAACCACGAAGGCTGTGCTGTTTGCAAAGAAAAT CAACACCACCAACGGGAA

GAGTGACTTCCAGGTGCCCTGTCAGTATTCTCAGCAGCTGAAAAGCTTCTCCTGCCAGGTGGAGATCCTGGAGGGTGACAAAGTATACCACATAGTGTCA

CTGTGCGTTGCAAACAGTGTGGGAAGCAAGTCCAGCCACAACGAAGCGTTTCACAGCTTAAAAATGG TGCAGCCGGATCCACCTGCCAACCTTGTGGTA

TCAGCCATACCTGGAAGGCCGCGCTGGCTCAAAGTCAGCTGGCAGCACCCTGAGACCTGGGACCCGAGTTACTACTTGCTGCAGTTCCAGCTTCGATACC

GACCTGTATGGTCAAAGGAGTTCACGGTGTTGCTG CTCCCGGTGGCCCAGTACCAATGCGTCATCCATGATGCCTTGCGAGGAGTGAAGCACGTGGTCC

AGGTCCGTGGGAAGGAGGAGCTTGACCTTGGCCAGTGGAGCGAATGGTCCCCAGAGGTCACGGGCACTCCTTGGATAG CAGAGCCCAGGACCACCCCGG

CAGGAATCCTCTGGAACCCCACACAG GTCTCTGTTGAAGACTCTGCCAACCACGAGGATCAGTACGAAAGTTCTACAGAAGCAACGAGTGTCCTCG CC

CCAGTGCAAGAATCCTCGTCCATGTCCCTGCCCACATTCCTGGTAGCTGGAGGAAGCTTGGCGTTTGGGTTGCTTCTCTGTGTCTTCATCATCCTGAG A

CTCAAGCAGAAATGGAAGTCAGAGGCTGAGAAGGAAAGCAAGACGACCTCTCCTCCACCCCCACCGTATTCCTTGGGCCCACTGAAGCCGACCTTCCTTC

TGGTTCCTCTCCTCACCCCACACAGCTCTGGGTCTGACAATACCGTAAACCACAGCTGCCTGGGTGTCAGGGACGCACAGAGCCCTTATGACAACAGCAA

CAGAGACTACTTATTCCCCAGATAATCATCTGGATGGTACCTGGCAGCTGGCAGGGCACCACGAGATCAGCACACAAGTTTCTCATGCGGGTCCCATCCA

CCTGGGGTGGGGTGGGGCGGGCGGGGCTGCAGCTTCACTAACCCACAAGAGCTCTGCACAGGTTCTGAGTAGGTGCAGCTGGTGCTGCATAGGCTCTGAA

GGAAGGAAGGGGCTGTGAGGAACACAGGCCATTGTGAAGACAGCTTGTGATGACTGAATAGAGATGCCCGTCAGCTCCACATCTGATAGTGGCTCACAAG

CTGCACCCTCAGGAGGCCTCAGAAAGGGGCTCCAAAGGCTGCCCCAGCTGCCTCGCTCTGCCTCACTGCCCCAAGCCACCTTTTAGCTCTCGAACTCCTA

AAGTCCAAGCACTTTGCCATTCTCTTTCCGAGGCCACTGAGGCCGGGTGGAAGCTTGGTTCCGATTTCCTTCTCAACATCTGGAAAGCAGCTGGGCCCGG

TGGTGGTGACTAATATCTCAGGGCCTGATGGTTTACGCGAGTGACAATTTCTCACAAGCAGTTTTTAAATGTGAATGATGACCCCAGGCACTGCTGGCTG

CGGAGGCTTCATTTTCCTCTTCGATCTCAGGACTTCAGGCGAAAAGCGGAGTGGAAGTAGAGAGCGGATGGGTGTCCACCGTCCTCATGGTACTTGCGGG

AGGTACAGCCTGGAAAACACGTTTCCTGTCCCCCTACTCTCCCAGGAGAGGGATGATGGTAGGGGGTGCCTCTTCCAGGGCGGAGAGAACTACTTTACCC

CAGCCTTGCCCATTCTGATTTCAACTGGACTGGAGCTACTAGGAAAGTCGACATTCATGCAAAAAGAAAAAACGTTAACTAGCAAGAATGCACTTTCATT

TTGGTTTTTAGAGAACTGTTGCCTGTTTCTCTCAAGAGTCTGGAAGAGGCCGCTCACTGCACACTACTGTATGAACCCTCACTGCCCACCCTGGAGGACC

AAGTGCAGTAACGGTAGCCCAAACACCAAGTCAAGTGAAAATCGAGGGAAAAAAAAAACAAACAAGC
Translation
MLTVGCTLLVALLAAPAVALVLGSCRALE - UNI20749 - EVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLS

DTGDYLCSLNDHLVGTVPLLVDV VPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKI INTTNGKSDFQVPCQYSQQLKSFSCQVEILEGD

KVYHIVSLCVANSVGSKSSHNEAFHSLKMV VQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLL LPVAQYQCVIHD

ALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIA AEPRTTPAGILWNPTQ VSVEDSANHEDQYESSTEATSVLA APVQESSSMSLPTFLVAGGSL

AFGLLLCVFIILR RLKQKWKSEAEKESKTTSPPPPPYSLGPLKPTFLLVPLLTPHSSGSDNTVNHSCLGVRDAQSPYDNSNRDYLFPR

For any suggestions or comments, please send an email to unitrap@crg.es