Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027951 (Adar)
Chromosomal location
Chr 3: 89518982 - 89557367 (+)
Description
adenosine deaminase, RNA-specific Gene [Source:MGI (curated);Acc:Adar-005]
RefSeq_dna
NM_001038587 NM_019655 
RefSeq_peptide
NP_001033676.1 NP_062629.2 
UniGene
Mm.316628 
MGI
MGI:1889575 
Uniprot/SWISSPROT
Q99MU3 
Uniprot/SPTREMBL
Q5J3Q7 Q5J3Q8 Q3UH31 Q5J4D4 Q3T9H2 Q4FJS9 Q5J4D5 
Human Ortholog
ENSG00000160710 (ADAR)
Omim 127400 - DYSCHROMATOSIS SYMMETRICA HEREDITARIA 1  
UniTrap UNI10917
Vector Insertion
Chr 3: 89519073 - 89534669
Public Clones (ggtc) D048H03 (ggtc) E061H04 (ggtc) IST14678C11 (tigm) IST10831E5 (tigm)
IST10439A3 (tigm) IST14506D8 (tigm) IST14582E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30277
Vector Insertion
Chr 3: 89534761 - 89538763
Public Clones D048H03 (ggtc) (ggtc) IST14530E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118341
Sequence
AACGAAAGTGAACTCTGGGGAGCCAGCCATCTTACGGCCACAGGTGCGGGCCTTGCCGGCACTATGTCTCAAGGGTTCAGGGGACCCACAG - UNI302

77 - ATTTAAATTCCAGGTTGTCATCAATGGGCGGGAATTTCCCCCAGCTGAGGCTGGCAGCAAGAAAGTAGCCAAGCAGGACGCAGCAGTGAAAGCCA

TGGCGATTCTGCTTCGGGAAGCCAAAGCCAAAGACAGTGGTCAACCAGAAGACTTGTCCCACTGTCCCATGGAAGAAGACTCGGAGAAA CCAGCAGAGG

CTCAGGCCCCCAGCTCCTCAGCAACATCCTTGTTCTCTGGGAAGAGCCCAGTTACTACACTGCTTGAGTGCATGCACAAACTAGGGAACTCCTGTGAATT

CCGTCTCCTGTCCAAAGAAGGCCCTGCTCATGACCCCAA GTTCCAGTACTGTGTAGCAGTAGGAGCCCAGACCTTCCCCCCTGTGAGCGCCCCCAGCAA

GAAGGTAGCAAAGCAGATGGCCGCAGAGGAAGCCATGAAGGCGCTGCAGGAGGAGGCAGCCAGTTCAGCGGATGACCAG TCTGGAGGTGCGAACACAGA

CTCACTTGATGAATCTATGGCTCCCAACAAGATCAGGAGGATTGGTGAGCTCGTCAGGTACCTGAACACCAACCCCGTAGGCGGCTTGTTGGAGTACGCC

CGATCTCATGGCTTTGCTGCTGAGTTCAAGCTCATTGACCAGTCTGGACCTCCTCACGAACCCAA GTTTGTTTACCAAGCAAAAGTTGGGGGCCGCTGG

TTTCCAGCCGTGTGTGCACACAGCAAGAAACAGGGCAAGCAGGATGCAGCGGATGCAGCCCTCCGGGTCTTGATCGGGGAGAGCGAGAAGGCAGAGCAGT

TGGGTTTCGCAGAGGTAACCCCAGTAACAGGGGCCAGTCTCAGAAGAACTATGCTCCTCCTTTCCAGGTCCCCAGATGCACATCCAAAGACA CTTCCTC

TCTCTGGCAGCACCTTCCACGACCAGATAGCTATGCTGAGCCACAGGTGCTTCAATGCTCTGACCAACAGTTTCCAGCCCTCCCTGCTCGGCCGCAAGAT

CCTGGCTGCCATTATTATGAAAAGAGATCCAGAGGACATGGGTGTTGTCGTGAGTTTGGGGACAG GCAATCGCTGTGTGAAAGGGGACTCTCTCAGCCT

GAAGGGAGAGACGGTCAATGACTGCCATGCCGAAATCATCTCCCGGAGGGGCTTCATCAG GTTTCTCTACAGTGAACTGATGAAGTACAACCACCACAC

TGCCAAGAACAGCATATTTGAGCTTGCCAGGGGAGGAGAGAAGCTGCAGATAAAGAAGACGGTTTCTTTTCATCTCTACATCAG CACGGCGCCATGTGG

AGATGGGGCCCTCTTTGACAAATCCTGCAGTGACCGTGCCGTGGAAAGCACAGAGTCCCGCCATTACCCTGTCTTTGAAAATCCCAAGCAAGGCAAGCTT

CGCACCAAGGTGGAGAATG GGGAAGGCACAATTCCTGTGGAGTCCAGTGATATTGTACCCACGTGGGATGGCATCCGCCTTGGGGAAAGACTCCGTACC

ATGTCCTGTAGTGACAAAATCCTACGCTGGAATGTGCTGGGCCTGCAAGGGGCGTTGTTGACGCACTTCCTACAGCCTGTGTACCTGAAATCTGTAACCT

TAG GTTACCTTTTCAGCCAAGGGCATCTGACCCGTGCTATTTGCTGCCGCGTGACCAGAGATGGGAAAGCATTTGAGGATGGACTACGCTATCCCTTTA

TTGTCAACCACCCCAAG GTCGGCCGAGTCAGTGTTTATGATTCCAAAAGACAGTCCGGAAAGACCAAGGAAACAAGCGTCAACTGGTGCATGGCTGATG

GCTATGACCTAGAGATCCTGGATGGCACCAGAGGCACTGTGGATGG ACCAGGGAAAGAGTTGTCTCGGGTGTCCAAGAAGAATATTTTCCTTCAGTTTA

AGAAGCTCTGCTCCTTCCGAGCCCGCAGAGATTTACTGCAGCTCTCTTATGGTGAAGCCAAGAAAGCTGCCCGTGACTATGACTTAGCCAAGAACTACTT

CAAGAAAAGCCTGCGAGACATGGGCTATGGGAATTGGATCAGCAAACCCCAGGAGGAAAAGAACTTTTACCTCTGTCCAGTACCCAATGACTGATAGTGG

GGCGCGTTTCTCCTGGGGTCAGAGGGCGGTCATGGCATTCCTCATCACACCGGGCCAGAGGATAGGAGCTTTTTTTACCCACTCCCCCCTTTTTTAATGG

TAGAACCATAATAGATGGTACCAAGAACTGCTTTCTTTGGGATTTCAAGGTGGGGTCCAGCCAAGTCCCCACCTCCCTTTTCTCAAGGGAAGAGGCCAAG

ATTAAAGGAAATGGAAATGCTACCA
Translation
 - UNI30277 - MAILLREAKAKDSGQPEDLSHCPMEEDSEK PAEAQAPSSSATSLFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHDPK KFQY

CVAVGAQTFPPVSAPSKKVAKQMAAEEAMKALQEEAASSADDQ SGGANTDSLDESMAPNKIRRIGELVRYLNTNPVGGLLEYARSHGFAAEFKLIDQSG

PPHEPK KFVYQAKVGGRWFPAVCAHSKKQGKQDAADAALRVLIGESEKAEQLGFAEVTPVTGASLRRTMLLLSRSPDAHPKT LPLSGSTFHDQIAMLS

HRCFNALTNSFQPSLLGRKILAAIIMKRDPEDMGVVVSLGTG GNRCVKGDSLSLKGETVNDCHAEIISRRGFIR RFLYSELMKYNHHTAKNSIFELAR

GGEKLQIKKTVSFHLYIS STAPCGDGALFDKSCSDRAVESTESRHYPVFENPKQGKLRTKVENG GEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKI

LRWNVLGLQGALLTHFLQPVYLKSVTLG GYLFSQGHLTRAICCRVTRDGKAFEDGLRYPFIVNHPK VGRVSVYDSKRQSGKTKETSVNWCMADGYDLE

ILDGTRGTVDG GPGKELSRVSKKNIFLQFKKLCSFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEKNFYLCPVPND
Transcript ENSMUST00000121094
Sequence
AACGAAAGTGAACTCTGGGGAGCCAGCCATCTTACGGCCACAGGTGCGGGCCTTGCCGGCACTATGTCTCAAGGGTTCAGGGGACCCACAG - UNI302

77 - ATTTAAATTCCAGGTTGTCATCAATGGGCGGGAATTTCCCCCAGCTGAGGCTGGCAGCAAGAAAGTAGCCAAGCAGGACGCAGCAGTGAAAGCCA

TGGCGATTCTGCTTCGGGAAGCCAAAGCCAAAGACAGTGGTCAACCAGAAGACTTGTCCCACTGTCCCATGGAAGAAGACTCGGAGAAA CCAGCAGAGG

CTCAGGCCCCCAGCTCCTCAGCAACATCCTTGTTCTCTGGGAAGAGCCCAGTTACTACACTGCTTGAGTGCATGCACAAACTAGGGAACTCCTGTGAATT

CCGTCTCCTGTCCAAAGAAGGCCCTGCTCATGACCCCAA GTTCCAGTACTGTGTAGCAGTAGGAGCCCAGACCTTCCCCCCTGTGAGCGCCCCCAGCAA

GAAGGTAGCAAAGCAGATGGCCGCAGAGGAAGCCATGAAGGCGCTGCAGGAGGAGGCAGCCAGTTCAGCGGATGACCAG TCTGGAGGTGCGAACACAGA

CTCACTTGATGAATCTATGGCTCCCAACAAGATCAGGAGGATTGGTGAGCTCGTCAGGTACCTGAACACCAACCCCGTAGGCGGCTTGTTGGAGTACGCC

CGATCTCATGGCTTTGCTGCTGAGTTCAAGCTCATTGACCAGTCTGGACCTCCTCACGAACCCAA GTTTGTTTACCAAGCAAAAGTTGGGGGCCGCTGG

TTTCCAGCCGTGTGTGCACACAGCAAGAAACAGGGCAAGCAGGATGCAGCGGATGCAGCCCTCCGGGTCTTGATCGGGGAGAGCGAGAAGGCAGAGCAGT

TGGGTTTCGCAGAG CTTCCTCTCTCTGGCAGCACCTTCCACGACCAGATAGCTATGCTGAGCCACAGGTGCTTCAATGCTCTGACCAACAGTTTCCAGC

CCTCCCTGCTCGGCCGCAAGATCCTGGCTGCCATTATTATGAAAAGAGATCCAGAGGACATGGGTGTTGTCGTGAGTTTGGGGACAG GCAATCGCTGTG

TGAAAGGGGACTCTCTCAGCCTGAAGGGAGAGACGGTCAATGACTGCCATGCCGAAATCATCTCCCGGAGGGGCTTCATCAG GTTTCTCTACAGTGAAC

TGATGAAGTACAACCACCACACTGCCAAGAACAGCATATTTGAGCTTGCCAGGGGAGGAGAGAAGCTGCAGATAAAGAAGACGGTTTCTTTTCATCTCTA

CATCAG CACGGCGCCATGTGGAGATGGGGCCCTCTTTGACAAATCCTGCAGTGACCGTGCCGTGGAAAGCACAGAGTCCCGCCATTACCCTGTCTTTGA

AAATCCCAAGCAAGGCAAGCTTCGCACCAAGGTGGAGAATG GGGAAGGCACAATTCCTGTGGAGTCCAGTGATATTGTACCCACGTGGGATGGCATCCG

CCTTGGGGAAAGACTCCGTACCATGTCCTGTAGTGACAAAATCCTACGCTGGAATGTGCTGGGCCTGCAAGGGGCGTTGTTGACGCACTTCCTACAGCCT

GTGTACCTGAAATCTGTAACCTTAG GTTACCTTTTCAGCCAAGGGCATCTGACCCGTGCTATTTGCTGCCGCGTGACCAGAGATGGGAAAGCATTTGAG

GATGGACTACGCTATCCCTTTATTGTCAACCACCCCAAG GTCGGCCGAGTCAGTGTTTATGATTCCAAAAGACAGTCCGGAAAGACCAAGGAAACAAGC

GTCAACTGGTGCATGGCTGATGGCTATGACCTAGAGATCCTGGATGGCACCAGAGGCACTGTGGATGG ACCAGGGAAAGAGTTGTCTCGGGTGTCCAAG

AAGAATATTTTCCTTCAGTTTAAGAAGCTCTGCTCCTTCCGAGCCCGCAGAGATTTACTGCAGCTCTCTTATGGTGAAGCCAAGAAAGCTGCCCGTGACT

ATGACTTAGCCAAGAACTACTTCAAGAAAAGCCTGCGAGACATGGGCTATGGGAATTGGATCAGCAAACCCCAGGAGGAAAAGAACTTTTACCTCTGTCC

AGTACCCAATGACTGATAGTGGGGCGCGTTTCTCCTGGGGTCAGAGGGCGGTCATGGCATTCCTCATCACACCGGGCCAGAGGATAGGAGCTTTTTTTAC

CCACTCCCCCCTTTTTTAATGGTAGAACCATAATAGATGGTACCAAGAACTGCTTTCTTTGGGATTTCAAGGTGGGGTCCAGCCAAGTCCCCACCTCCCT

TTTCTCAAGGGAAGAGGCCAAGATTAAAGGAAATGGAAATGCTACCA
Translation
 - UNI30277 - MAILLREAKAKDSGQPEDLSHCPMEEDSEK PAEAQAPSSSATSLFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHDPK KFQY

CVAVGAQTFPPVSAPSKKVAKQMAAEEAMKALQEEAASSADDQ SGGANTDSLDESMAPNKIRRIGELVRYLNTNPVGGLLEYARSHGFAAEFKLIDQSG

PPHEPK KFVYQAKVGGRWFPAVCAHSKKQGKQDAADAALRVLIGESEKAEQLGFAE LPLSGSTFHDQIAMLSHRCFNALTNSFQPSLLGRKILAAIIM

KRDPEDMGVVVSLGTG GNRCVKGDSLSLKGETVNDCHAEIISRRGFIR RFLYSELMKYNHHTAKNSIFELARGGEKLQIKKTVSFHLYIS STAPCGD

GALFDKSCSDRAVESTESRHYPVFENPKQGKLRTKVENG GEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPVYLKSVT

LG GYLFSQGHLTRAICCRVTRDGKAFEDGLRYPFIVNHPK VGRVSVYDSKRQSGKTKETSVNWCMADGYDLEILDGTRGTVDG GPGKELSRVSKKNI

FLQFKKLCSFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEKNFYLCPVPND
Transcript ENSMUST00000107404
Sequence
GCCACAGGTGCGGGCCTTGCCGGCACTATGTCTCAAGGGTTCAGGGGACCCACAG - UNI30277 - GGGTGTTCCCTCACCAGACACAGTCGTACTT

GGACCCTAGTCATGAGCATAGCAAGTGGAGATACCCGCAGCCACAGGGGCCGGAGTCTTACCCTAGGAGTTTCCAGCTTCAGCAGATAGAGTTTCTCAAA

GGGCGGCTCCCAGAAGCACCCTTGATTGGAATACAAACCCAGTCACTGCCGCCATTCCTCCCAGGACACTGGCCAAGATTCCCAGGGCCACCTGCCCAAG

ACAGGCAACTGGAAATCTGGGAGTTCCCCAGGAGTGTGACTCTCAGAAATCAGGGGTTCCACATAGGACCCCCACTTCCTCCCCCACACAGCAGGGGTAC

ACCATGGAGAGGTGCTGACGGGCTTTGCTCACACTTCCGGGAGCTGAGCATCAGTCAGAGTCCGGAGCAGAAGGTTCTAAACCGCCTGGAAGAGCTTGGG

GAGGGGAAGGCCACCACTGCCCATGTGCTAGCCAGAGAGCTCAGAATCCCCAAAAGGGACATCAATCGTATTTTGTACTCCCTGGAAAAGAAGGGAAAGC

TGCACAGAGGAAGGGGGAAACCTCCTTTGTGGAGCCTTGTGCCCTTGAGTCAGGCTTGGACTCAGCCCCCTGGAGTTGTGAATCCAGATAGTTGTATCCA

GGAATTCCCTAGAGGAGAGCCTGGTTTGGACAGTGAGGACGGAGACCCTGCCTCTGACTTAGAAGGACCTTCTGAGCCTCTTGACATGGCTGAAATCAAG

GAGAAGATCTGTGACTATCTGTTCAATGTGTCAAACTCCTCTGCCCTGAACCTGGCTAAGAACATTGGCCTCACCAAGGCCCGAGATGTGACCTCAGTGC

TGATTGACTTGGAAAGGCAAGGCGATGTCTACAGGCAAGGGGCAACTCCTCCCATCTGGTACTTGACGGACAAGAAGCGTGAGAGGCTGCAGATGAAGAG

AAGTACACACAGTGCTCCTGCCCCTACCCCGACAGCTGTCCCAGAGGCCACTAGAAGCCCCTCATTCCCTGCCTGCCACCCGCCCCCAGCAGGTGCCTCA

AGCAGTGTGGCAGCCTCCAAGAGAGTGGAGAATGGGCAGGAGCCTGCGATAAAGCATGAAAGTAGGCATGAGGCCAGACCAGGACCAATGAGACTGCGGC

CTCACGCTTATCACAATGGCCCCTCTAGAGCAGGGTATGTGGCCTCTGAAAATGGCCAGTGGGCCACAGATGACATCCCAGATAACTTGAATAGTATCCA

CACAGCACCAGGTGAGTTTCGAGCCATCATGGAGATGCCCTCCTTCTACAGCCCTACCTTGCCACGGTGTTCACCCTACAAGAAGCTAACTGAGTGCCAG

CTGAAGAACCCTGTCAGCGGGTTGTTAGAGTATGCTCAGTTCACTAGTCAGACCTGTGATTTCAACCTGATAGAGCAGAGTGGACCGTCCCATGAACCTC

G ATTTAAATTCCAGGTTGTCATCAATGGGCGGGAATTTCCCCCAGCTGAGGCTGGCAGCAAGAAAGTAGCCAAGCAGGACGCAGCAGTGAAAGCCATGG

CGATTCTGCTTCGGGAAGCCAAAGCCAAAGACAGTGGTCAACCAGAAGACTTGTCCCACTGTCCCATGGAAGAAGACTCGGAGAAA CCAGCAGAGGCTC

AGGCCCCCAGCTCCTCAGCAACATCCTTGTTCTCTGGGAAGAGCCCAGTTACTACACTGCTTGAGTGCATGCACAAACTAGGGAACTCCTGTGAATTCCG

TCTCCTGTCCAAAGAAGGCCCTGCTCATGACCCCAA GTTCCAGTACTGTGTAGCAGTAGGAGCCCAGACCTTCCCCCCTGTGAGCGCCCCCAGCAAGAA

GGTAGCAAAGCAGATGGCCGCAGAGGAAGCCATGAAGGCGCTGCAGGAGGAGGCAGCCAGTTCAGCGGATGACCAG TCTGGAGGTGCGAACACAGACTC

ACTTGATGAATCTATGGCTCCCAACAAGATCAGGAGGATTGGTGAGCTCGTCAGGTACCTGAACACCAACCCCGTAGGCGGCTTGTTGGAGTACGCCCGA

TCTCATGGCTTTGCTGCTGAGTTCAAGCTCATTGACCAGTCTGGACCTCCTCACGAACCCAA GTTTGTTTACCAAGCAAAAGTTGGGGGCCGCTGGTTT

CCAGCCGTGTGTGCACACAGCAAGAAACAGGGCAAGCAGGATGCAGCGGATGCAGCCCTCCGGGTCTTGATCGGGGAGAGCGAGAAGGCAGAGCAGTTGG

GTTTCGCAGAGGTAACCCCAGTAACAGGGGCCAGTCTCAGAAGAACTATGCTCCTCCTTTCCAGGTCCCCAGATGCACATCCAAAGACA CTTCCTCTCT

CTGGCAGCACCTTCCACGACCAGATAGCTATGCTGAGCCACAGGTGCTTCAATGCTCTGACCAACAGTTTCCAGCCCTCCCTGCTCGGCCGCAAGATCCT

GGCTGCCATTATTATGAAAAGAGATCCAGAGGACATGGGTGTTGTCGTGAGTTTGGGGACAG GCAATCGCTGTGTGAAAGGGGACTCTCTCAGCCTGAA

GGGAGAGACGGTCAATGACTGCCATGCCGAAATCATCTCCCGGAGGGGCTTCATCAG GTTTCTCTACAGTGAACTGATGAAGTACAACCACCACACTGC

CAAGAACAGCATATTTGAGCTTGCCAGGGGAGGAGAGAAGCTGCAGATAAAGAAGACGGTTTCTTTTCATCTCTACATCAG CACGGCGCCATGTGGAGA

TGGGGCCCTCTTTGACAAATCCTGCAGTGACCGTGCCGTGGAAAGCACAGAGTCCCGCCATTACCCTGTCTTTGAAAATCCCAAGCAAGGCAAGCTTCGC

ACCAAGGTGGAGAATG GGGAAGGCACAATTCCTGTGGAGTCCAGTGATATTGTACCCACGTGGGATGGCATCCGCCTTGGGGAAAGACTCCGTACCATG

TCCTGTAGTGACAAAATCCTACGCTGGAATGTGCTGGGCCTGCAAGGGGCGTTGTTGACGCACTTCCTACAGCCTGTGTACCTGAAATCTGTAACCTTAG

 GTTACCTTTTCAGCCAAGGGCATCTGACCCGTGCTATTTGCTGCCGCGTGACCAGAGATGGGAAAGCATTTGAGGATGGACTACGCTATCCCTTTATTG

TCAACCACCCCAAG GTCGGCCGAGTCAGTGTTTATGATTCCAAAAGACAGTCCGGAAAGACCAAGGAAACAAGCGTCAACTGGTGCATGGCTGATGGCT

ATGACCTAGAGATCCTGGATGGCACCAGAGGCACTGTGGATGG ACCAGGGAAAGAGTTGTCTCGGGTGTCCAAGAAGAATATTTTCCTTCAGTTTAAGA

AGCTCTGCTCCTTCCGAGCCCGCAGAGATTTACTGCAGCTCTCTTATGGTGAAGCCAAGAAAGCTGCCCGTGACTATGACTTAGCCAAGAACTACTTCAA

GAAAAGCCTGCGAGACATGGGCTATGGGAATTGGATCAGCAAACCCCAGGAGGAAAAGAACTTTTACCTCTGTCCAGTACCCAATGACTGATAGTGGGGC

GCGTTTCTCCTGGGGTCAGAGGGCGGTCATGGCATTCCTCATCACACCGGGCCAGAGGATAGGAGCTTTTTTTACCCACTCCCCCCTTTTTTAATGGTAG

AACCATAATAGATGGTACCAAGAACTGCTTTCTTTGGGATTTCAAGGTGGGGTCCAGCCAAGTCCCCACCTCCCTTTTCTCAAGGGAAGAGGCCAAGATT

AAAGGAAATGGAAATGCTACC
Translation
 - UNI30277 - MAEIKEKICDYLFNVSNSSALNLAKNIGLTKARDVTSVLIDLERQGDVYRQGATPPIWYLTDKKRERLQMKRSTHSAPAPTPTAVP

EATRSPSFPACHPPPAGASSSVAASKRVENGQEPAIKHESRHEARPGPMRLRPHAYHNGPSRAGYVASENGQWATDDIPDNLNSIHTAPGEFRAIMEMPS

FYSPTLPRCSPYKKLTECQLKNPVSGLLEYAQFTSQTCDFNLIEQSGPSHEPR RFKFQVVINGREFPPAEAGSKKVAKQDAAVKAMAILLREAKAKDSG

QPEDLSHCPMEEDSEK PAEAQAPSSSATSLFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHDPK KFQYCVAVGAQTFPPVSAPSKKVAKQMAAEEA

MKALQEEAASSADDQ SGGANTDSLDESMAPNKIRRIGELVRYLNTNPVGGLLEYARSHGFAAEFKLIDQSGPPHEPK KFVYQAKVGGRWFPAVCAHSK

KQGKQDAADAALRVLIGESEKAEQLGFAEVTPVTGASLRRTMLLLSRSPDAHPKT LPLSGSTFHDQIAMLSHRCFNALTNSFQPSLLGRKILAAIIMKR

DPEDMGVVVSLGTG GNRCVKGDSLSLKGETVNDCHAEIISRRGFIR RFLYSELMKYNHHTAKNSIFELARGGEKLQIKKTVSFHLYIS STAPCGDGA

LFDKSCSDRAVESTESRHYPVFENPKQGKLRTKVENG GEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPVYLKSVTLG

 GYLFSQGHLTRAICCRVTRDGKAFEDGLRYPFIVNHPK VGRVSVYDSKRQSGKTKETSVNWCMADGYDLEILDGTRGTVDG GPGKELSRVSKKNIFL

QFKKLCSFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEKNFYLCPVPND
Transcript ENSMUST00000098924
Sequence
GACTGAAGGTGGAAGACTACGCGTTGGGACTAGCCGGGAAGGGCGCAGCCTTGGGCTCACGAGTGGGCAGCGTCCGAGGAATCGCGCGCGG - UNI109

17 - - UNI30277 - GGGTGTTCCCTCACCAGACACAGTCGTACTTGGACCCTAGTCATGAGCATAGCAAGTGGAGATACCCGCAGCCACAGGGGCC

GGAGTCTTACCCTAGGAGTTTCCAGCTTCAGCAGATAGAGTTTCTCAAAGGGCGGCTCCCAGAAGCACCCTTGATTGGAATACAAACCCAGTCACTGCCG

CCATTCCTCCCAGGACACTGGCCAAGATTCCCAGGGCCACCTGCCCAAGACAGGCAACTGGAAATCTGGGAGTTCCCCAGGAGTGTGACTCTCAGAAATC

AGGGGTTCCACATAGGACCCCCACTTCCTCCCCCACACAGCAGGGGTACACCATGGAGAGGTGCTGACGGGCTTTGCTCACACTTCCGGGAGCTGAGCAT

CAGTCAGAGTCCGGAGCAGAAGGTTCTAAACCGCCTGGAAGAGCTTGGGGAGGGGAAGGCCACCACTGCCCATGTGCTAGCCAGAGAGCTCAGAATCCCC

AAAAGGGACATCAATCGTATTTTGTACTCCCTGGAAAAGAAGGGAAAGCTGCACAGAGGAAGGGGGAAACCTCCTTTGTGGAGCCTTGTGCCCTTGAGTC

AGGCTTGGACTCAGCCCCCTGGAGTTGTGAATCCAGATAGTTGTATCCAGGAATTCCCTAGAGGAGAGCCTGGTTTGGACAGTGAGGACGGAGACCCTGC

CTCTGACTTAGAAGGACCTTCTGAGCCTCTTGACATGGCTGAAATCAAGGAGAAGATCTGTGACTATCTGTTCAATGTGTCAAACTCCTCTGCCCTGAAC

CTGGCTAAGAACATTGGCCTCACCAAGGCCCGAGATGTGACCTCAGTGCTGATTGACTTGGAAAGGCAAGGCGATGTCTACAGGCAAGGGGCAACTCCTC

CCATCTGGTACTTGACGGACAAGAAGCGTGAGAGGCTGCAGATGAAGAGAAGTACACACAGTGCTCCTGCCCCTACCCCGACAGCTGTCCCAGAGGCCAC

TAGAAGCCCCTCATTCCCTGCCTGCCACCCGCCCCCAGCAGGTGCCTCAAGCAGTGTGGCAGCCTCCAAGAGAGTGGAGAATGGGCAGGAGCCTGCGATA

AAGCATGAAAGTAGGCATGAGGCCAGACCAGGACCAATGAGACTGCGGCCTCACGCTTATCACAATGGCCCCTCTAGAGCAGGGTATGTGGCCTCTGAAA

ATGGCCAGTGGGCCACAGATGACATCCCAGATAACTTGAATAGTATCCACACAGCACCAGGTGAGTTTCGAGCCATCATGGAGATGCCCTCCTTCTACAG

CCCTACCTTGCCACGGTGTTCACCCTACAAGAAGCTAACTGAGTGCCAGCTGAAGAACCCTGTCAGCGGGTTGTTAGAGTATGCTCAGTTCACTAGTCAG

ACCTGTGATTTCAACCTGATAGAGCAGAGTGGACCGTCCCATGAACCTCG ATTTAAATTCCAGGTTGTCATCAATGGGCGGGAATTTCCCCCAGCTGAG

GCTGGCAGCAAGAAAGTAGCCAAGCAGGACGCAGCAGTGAAAGCCATGGCGATTCTGCTTCGGGAAGCCAAAGCCAAAGACAGTGGTCAACCAGAAGACT

TGTCCCACTGTCCCATGGAAGAAGACTCGGAGAAA CCAGCAGAGGCTCAGGCCCCCAGCTCCTCAGCAACATCCTTGTTCTCTGGGAAGAGCCCAGTTA

CTACACTGCTTGAGTGCATGCACAAACTAGGGAACTCCTGTGAATTCCGTCTCCTGTCCAAAGAAGGCCCTGCTCATGACCCCAA GTTCCAGTACTGTG

TAGCAGTAGGAGCCCAGACCTTCCCCCCTGTGAGCGCCCCCAGCAAGAAGGTAGCAAAGCAGATGGCCGCAGAGGAAGCCATGAAGGCGCTGCAGGAGGA

GGCAGCCAGTTCAGCGGATGACCAG TCTGGAGGTGCGAACACAGACTCACTTGATGAATCTATGGCTCCCAACAAGATCAGGAGGATTGGTGAGCTCGT

CAGGTACCTGAACACCAACCCCGTAGGCGGCTTGTTGGAGTACGCCCGATCTCATGGCTTTGCTGCTGAGTTCAAGCTCATTGACCAGTCTGGACCTCCT

CACGAACCCAA GTTTGTTTACCAAGCAAAAGTTGGGGGCCGCTGGTTTCCAGCCGTGTGTGCACACAGCAAGAAACAGGGCAAGCAGGATGCAGCGGAT

GCAGCCCTCCGGGTCTTGATCGGGGAGAGCGAGAAGGCAGAGCAGTTGGGTTTCGCAGAGGTAACCCCAGTAACAGGGGCCAGTCTCAGAAGAACTATGC

TCCTCCTTTCCAGGTCCCCAGATGCACATCCAAAGACA CTTCCTCTCTCTGGCAGCACCTTCCACGACCAGATAGCTATGCTGAGCCACAGGTGCTTCA

ATGCTCTGACCAACAGTTTCCAGCCCTCCCTGCTCGGCCGCAAGATCCTGGCTGCCATTATTATGAAAAGAGATCCAGAGGACATGGGTGTTGTCGTGAG

TTTGGGGACAG GCAATCGCTGTGTGAAAGGGGACTCTCTCAGCCTGAAGGGAGAGACGGTCAATGACTGCCATGCCGAAATCATCTCCCGGAGGGGCTT

CATCAG GTTTCTCTACAGTGAACTGATGAAGTACAACCACCACACTGCCAAGAACAGCATATTTGAGCTTGCCAGGGGAGGAGAGAAGCTGCAGATAAA

GAAGACGGTTTCTTTTCATCTCTACATCAG CACGGCGCCATGTGGAGATGGGGCCCTCTTTGACAAATCCTGCAGTGACCGTGCCGTGGAAAGCACAGA

GTCCCGCCATTACCCTGTCTTTGAAAATCCCAAGCAAGGCAAGCTTCGCACCAAGGTGGAGAATG GGGAAGGCACAATTCCTGTGGAGTCCAGTGATAT

TGTACCCACGTGGGATGGCATCCGCCTTGGGGAAAGACTCCGTACCATGTCCTGTAGTGACAAAATCCTACGCTGGAATGTGCTGGGCCTGCAAGGGGCG

TTGTTGACGCACTTCCTACAGCCTGTGTACCTGAAATCTGTAACCTTAG GTTACCTTTTCAGCCAAGGGCATCTGACCCGTGCTATTTGCTGCCGCGTG

ACCAGAGATGGGAAAGCATTTGAGGATGGACTACGCTATCCCTTTATTGTCAACCACCCCAAG GTCGGCCGAGTCAGTGTTTATGATTCCAAAAGACAG

TCCGGAAAGACCAAGGAAACAAGCGTCAACTGGTGCATGGCTGATGGCTATGACCTAGAGATCCTGGATGGCACCAGAGGCACTGTGGATGG ACCAGGG

AAAGAGTTGTCTCGGGTGTCCAAGAAGAATATTTTCCTTCAGTTTAAGAAGCTCTGCTCCTTCCGAGCCCGCAGAGATTTACTGCAGCTCTCTTATGGTG

AAGCCAAGAAAGCTGCCCGTGACTATGACTTAGCCAAGAACTACTTCAAGAAAAGCCTGCGAGACATGGGCTATGGGAATTGGATCAGCAAACCCCAGGA

GGAAAAGAACTTTTACCTCTGTCCAGTACCCAATGACTGATAGTGGGGCGCGTTTCTCCTGGGGTCAGAGGGCGGTCATGGCATTCCTCATCACACCGGG

CCAGAGGATAGGAGCTTTTTTTACCCACTCCCCCCTTTTTTAATGGTAGAACCATAATAGATGGTACCAAGAACTGCTTTCTTTGGGATTTCAAGGTGGG

GTCCAGCCAAGTCCCCACCTCCCTTTTCTCAAGGGAAGAGGCCAAGATTAAAGGAAATGGAAATGCTACCATTCCATATGTAGCACAGACAGTTCTTGGT

CACATGGAGCCCAGGCCCCTCGGGCTTCGTTTTGCGGAGGTTTTTTTCATCTCCTTTTCCTTTGCTGCACTGGCCTCTTGTGGGTTTGATTCCATCCCAT

CAGTTCTCTGTAAATGATGTCAGGGGCCAGTGATGTCACCTGCAGATGCGCAGGCAGGCCCCTGCTCTGTCATCCTTCCCTCCTAGGATGCCTTCCTGTG

ATGAGGTTTCTCCTTCCCCACCCCAGAGGATAGAGGTGAACATAAAGGATTGGTGAAATGTTTACAAGGGCAGGAGTTGACAACCGTGGTCAGGGATTGT

CGAACAACAGGAATGTGGTAAACTGTGGTTGGGACAGGCAAGCCCTACCCAGTAACAGGCCGTGCTGGCCCACCAAGGAACTTCCCTTCCTGGGCAGCAG

GGAAGTTGAGAATCGGCCAGTGGGACCGAGGAAGGTACCCAAACCAAGCACGTCCCAGTAGGGGTCCACAAGCACTAACTAGAGTGCACCAGCATTCCAT

GGAATGTCGCTATGCCTCCATCTGCCCCTCCATGAGCACTCCCAGAAGCTGGCCCTGGGCACGTGTGGTGTTGGCCCCAGGCCCCAGCTGTTTGTGAAAA

GCAGAGGGTGAGCATAGTGGGCAGAGCAGCTTTGCCCAGACGGCAAAGGTAAAGGCAGAGCATCCTGCCGGTGCACTGGGATTCTTCTGGTCTCAGCAGA

AGTGACAAAGCCCTGCATAGAATTAATGTTTCTAAAAGGCCAGAGGCATTGATTCTGAACTGCATCAAAGACTGGAGATGCAAATATTACTTCTCCATTA

GTAAATGTACTTTCATTCTATCAGATGGCTTCAGAAGCTGGGTCACGGACAGGGCACAGGGCCCTGGAATCTCTGCCCTGCTCCTTTGAGGATCTTCATT

TACATACAAGTGTTGTAGGTGGCAGGGCAGGCTGGCCTCCCACTCTGGGATGGGCTTCTTTGACTCCTCCCCCTCTGACAGTGACTTGTGGGTATGTGGG

AGCCTCTGTAGAATCTGGTTCTAGCATCAGATCAACCAGCCAGACCCTGCTCCATTCTGCCCCTCTAGGACCAAGCCCACCTCTTTCCTCTGAATGGTGT

GGCTCCATCTGGAGACAGCTGGCCAGTGTGTTCAACAGTTTCCTGCACCCCCTTGCTTAACCCTCAGAGCTGCCTGGTTCCCCCACCCTCTGGCCCACTG

CCAACAGCAAACATCACATTCGTACTTCAAGTCTAATGGCTACTGCCTCCTCAATCTATGAACAGATCTGGCCAACACAAGAACCTGTGTCTTCACAATA

CACTGGGGATGTCTTTGCACAGCCAAATCATCCTATGAAACTCCAGCGTCTGTGGAAGTGAGAAAGCAGCACCATGCTTGTGGTGTCGGCTGGAGGCGTG

TCACCCTCCGGCAACTGCATCTGAAGCAGAGCCCTTGTGGTTTCCAGGCCTGGACAGGGAGCTCTTCCCCTGGGGTCTAAAGGACAGAGATGTCTCTCCC

TTTGATTCCTTTGGTCCCTCTGGTCCTCCCTGGGTATTCACACATACCCCAATCCTGTCTAGACAACGAGTGGTTCTGGGTTTCTGCAGATGGAAGAGAG

CAAGGTGTCCCTGAGTTCTGTGGACTTGACCCCCGCATCCCACCCTGACCCTGCCTCCAGTCCCGCTGGCCGAGGGCAGAGCCTCCTCCCACTGTGCTTC

CTTCACGTTTACTTTAAGAAGCAGGGCCTCCCTCCACACCGTCTCTTAATACTTTCTGTAGTTGATTTGTCTGAACCGTGGCTGTCTTGCATTCCTTGAA

TAATCATGTGTAAGAATTGTCAATGCTTGAAACTATTTCCTGTACTCAAGTTGAAGGGACTTTGTTGGCCTTGGGGTTTTAGCAGTGACTCCAAGAGCAG

AGTGGGGAAGCACCCAGGCATAGCCTTGGCGCTGTGATGGATGCAGTCCCTCCCTCTGTCCCTTTACAAGTGACAGTATACATTCCTAAAAATAAAAACA

CTGAAGCATC
Translation
 - UNI10917 - - UNI30277 - MAEIKEKICDYLFNVSNSSALNLAKNIGLTKARDVTSVLIDLERQGDVYRQGATPPIWYLTDKKRERLQMKRS

THSAPAPTPTAVPEATRSPSFPACHPPPAGASSSVAASKRVENGQEPAIKHESRHEARPGPMRLRPHAYHNGPSRAGYVASENGQWATDDIPDNLNSIHT

APGEFRAIMEMPSFYSPTLPRCSPYKKLTECQLKNPVSGLLEYAQFTSQTCDFNLIEQSGPSHEPR RFKFQVVINGREFPPAEAGSKKVAKQDAAVKAM

AILLREAKAKDSGQPEDLSHCPMEEDSEK PAEAQAPSSSATSLFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHDPK KFQYCVAVGAQTFPPVSAP

SKKVAKQMAAEEAMKALQEEAASSADDQ SGGANTDSLDESMAPNKIRRIGELVRYLNTNPVGGLLEYARSHGFAAEFKLIDQSGPPHEPK KFVYQAKV

GGRWFPAVCAHSKKQGKQDAADAALRVLIGESEKAEQLGFAEVTPVTGASLRRTMLLLSRSPDAHPKT LPLSGSTFHDQIAMLSHRCFNALTNSFQPSL

LGRKILAAIIMKRDPEDMGVVVSLGTG GNRCVKGDSLSLKGETVNDCHAEIISRRGFIR RFLYSELMKYNHHTAKNSIFELARGGEKLQIKKTVSFHL

YIS STAPCGDGALFDKSCSDRAVESTESRHYPVFENPKQGKLRTKVENG GEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTH

FLQPVYLKSVTLG GYLFSQGHLTRAICCRVTRDGKAFEDGLRYPFIVNHPK VGRVSVYDSKRQSGKTKETSVNWCMADGYDLEILDGTRGTVDG GPG

KELSRVSKKNIFLQFKKLCSFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEKNFYLCPVPND
Transcript ENSMUST00000029563
Sequence
GCCACAGGTGCGGGCCTTGCCGGCACTATGTCTCAAGGGTTCAGGGGACCCACAG - UNI30277 - GGGTGTTCCCTCACCAGACACAGTCGTACTT

GGACCCTAGTCATGAGCATAGCAAGTGGAGATACCCGCAGCCACAGGGGCCGGAGTCTTACCCTAGGAGTTTCCAGCTTCAGCAGATAGAGTTTCTCAAA

GGGCGGCTCCCAGAAGCACCCTTGATTGGAATACAAACCCAGTCACTGCCGCCATTCCTCCCAGGACACTGGCCAAGATTCCCAGGGCCACCTGCCCAAG

ACAGGCAACTGGAAATCTGGGAGTTCCCCAGGAGTGTGACTCTCAGAAATCAGGGGTTCCACATAGGACCCCCACTTCCTCCCCCACACAGCAGGGGTAC

ACCATGGAGAGGTGCTGACGGGCTTTGCTCACACTTCCGGGAGCTGAGCATCAGTCAGAGTCCGGAGCAGAAGGTTCTAAACCGCCTGGAAGAGCTTGGG

GAGGGGAAGGCCACCACTGCCCATGTGCTAGCCAGAGAGCTCAGAATCCCCAAAAGGGACATCAATCGTATTTTGTACTCCCTGGAAAAGAAGGGAAAGC

TGCACAGAGGAAGGGGGAAACCTCCTTTGTGGAGCCTTGTGCCCTTGAGTCAGGCTTGGACTCAGCCCCCTGGAGTTGTGAATCCAGATAGTTGTATCCA

GGAATTCCCTAGAGGAGAGCCTGGTTTGGACAGTGAGGACGGAGACCCTGCCTCTGACTTAGAAGGACCTTCTGAGCCTCTTGACATGGCTGAAATCAAG

GAGAAGATCTGTGACTATCTGTTCAATGTGTCAAACTCCTCTGCCCTGAACCTGGCTAAGAACATTGGCCTCACCAAGGCCCGAGATGTGACCTCAGTGC

TGATTGACTTGGAAAGGCAAGGCGATGTCTACAGGCAAGGGGCAACTCCTCCCATCTGGTACTTGACGGACAAGAAGCGTGAGAGGCTGCAGATGAAGAG

AAGTACACACAGTGCTCCTGCCCCTACCCCGACAGCTGTCCCAGAGGCCACTAGAAGCCCCTCATTCCCTGCCTGCCACCCGCCCCCAGCAGGTGCCTCA

AGCAGTGTGGCAGCCTCCAAGAGAGTGGAGAATGGGCAGGAGCCTGCGATAAAGCATGAAAGTAGGCATGAGGCCAGACCAGGACCAATGAGACTGCGGC

CTCACGCTTATCACAATGGCCCCTCTAGAGCAGGGTATGTGGCCTCTGAAAATGGCCAGTGGGCCACAGATGACATCCCAGATAACTTGAATAGTATCCA

CACAGCACCAGGTGAGTTTCGAGCCATCATGGAGATGCCCTCCTTCTACAGCCCTACCTTGCCACGGTGTTCACCCTACAAGAAGCTAACTGAGTGCCAG

CTGAAGAACCCTGTCAGCGGGTTGTTAGAGTATGCTCAGTTCACTAGTCAGACCTGTGATTTCAACCTGATAGAGCAGAGTGGACCGTCCCATGAACCTC

G ATTTAAATTCCAGGTTGTCATCAATGGGCGGGAATTTCCCCCAGCTGAGGCTGGCAGCAAGAAAGTAGCCAAGCAGGACGCAGCAGTGAAAGCCATGG

CGATTCTGCTTCGGGAAGCCAAAGCCAAAGACAGTGGTCAACCAGAAGACTTGTCCCACTGTCCCATGGAAGAAGACTCGGAGAAA CCAGCAGAGGCTC

AGGCCCCCAGCTCCTCAGCAACATCCTTGTTCTCTGGGAAGAGCCCAGTTACTACACTGCTTGAGTGCATGCACAAACTAGGGAACTCCTGTGAATTCCG

TCTCCTGTCCAAAGAAGGCCCTGCTCATGACCCCAA GTTCCAGTACTGTGTAGCAGTAGGAGCCCAGACCTTCCCCCCTGTGAGCGCCCCCAGCAAGAA

GGTAGCAAAGCAGATGGCCGCAGAGGAAGCCATGAAGGCGCTGCAGGAGGAGGCAGCCAGTTCAGCGGATGACCAG TCTGGAGGTGCGAACACAGACTC

ACTTGATGAATCTATGGCTCCCAACAAGATCAGGAGGATTGGTGAGCTCGTCAGGTACCTGAACACCAACCCCGTAGGCGGCTTGTTGGAGTACGCCCGA

TCTCATGGCTTTGCTGCTGAGTTCAAGCTCATTGACCAGTCTGGACCTCCTCACGAACCCAA GTTTGTTTACCAAGCAAAAGTTGGGGGCCGCTGGTTT

CCAGCCGTGTGTGCACACAGCAAGAAACAGGGCAAGCAGGATGCAGCGGATGCAGCCCTCCGGGTCTTGATCGGGGAGAGCGAGAAGGCAGAGCAGTTGG

GTTTCGCAGAG CTTCCTCTCTCTGGCAGCACCTTCCACGACCAGATAGCTATGCTGAGCCACAGGTGCTTCAATGCTCTGACCAACAGTTTCCAGCCCT

CCCTGCTCGGCCGCAAGATCCTGGCTGCCATTATTATGAAAAGAGATCCAGAGGACATGGGTGTTGTCGTGAGTTTGGGGACAG GCAATCGCTGTGTGA

AAGGGGACTCTCTCAGCCTGAAGGGAGAGACGGTCAATGACTGCCATGCCGAAATCATCTCCCGGAGGGGCTTCATCAG GTTTCTCTACAGTGAACTGA

TGAAGTACAACCACCACACTGCCAAGAACAGCATATTTGAGCTTGCCAGGGGAGGAGAGAAGCTGCAGATAAAGAAGACGGTTTCTTTTCATCTCTACAT

CAG CACGGCGCCATGTGGAGATGGGGCCCTCTTTGACAAATCCTGCAGTGACCGTGCCGTGGAAAGCACAGAGTCCCGCCATTACCCTGTCTTTGAAAA

TCCCAAGCAAGGCAAGCTTCGCACCAAGGTGGAGAATG GGGAAGGCACAATTCCTGTGGAGTCCAGTGATATTGTACCCACGTGGGATGGCATCCGCCT

TGGGGAAAGACTCCGTACCATGTCCTGTAGTGACAAAATCCTACGCTGGAATGTGCTGGGCCTGCAAGGGGCGTTGTTGACGCACTTCCTACAGCCTGTG

TACCTGAAATCTGTAACCTTAG GTTACCTTTTCAGCCAAGGGCATCTGACCCGTGCTATTTGCTGCCGCGTGACCAGAGATGGGAAAGCATTTGAGGAT

GGACTACGCTATCCCTTTATTGTCAACCACCCCAAG GTCGGCCGAGTCAGTGTTTATGATTCCAAAAGACAGTCCGGAAAGACCAAGGAAACAAGCGTC

AACTGGTGCATGGCTGATGGCTATGACCTAGAGATCCTGGATGGCACCAGAGGCACTGTGGATGG ACCAGGGAAAGAGTTGTCTCGGGTGTCCAAGAAG

AATATTTTCCTTCAGTTTAAGAAGCTCTGCTCCTTCCGAGCCCGCAGAGATTTACTGCAGCTCTCTTATGGTGAAGCCAAGAAAGCTGCCCGTGACTATG

ACTTAGCCAAGAACTACTTCAAGAAAAGCCTGCGAGACATGGGCTATGGGAATTGGATCAGCAAACCCCAGGAGGAAAAGAACTTTTACCTCTGTCCAGT

ACCCAATGACTGATAGTGGGGCGCGTTTCTCCTGGGGTCAGAGGGCGGTCATGGCATTCCTCATCACACCGGGCCAGAGGATAGGAGCTTTTTTTACCCA

CTCCCCCCTTTTTTAATGGTAGAACCATAATAGATGGTACCAAGAACTGCTTTCTTTGGGATTTCAAGGTGGGGTCCAGCCAAGTCCCCACCTCCCTTTT

CTCAAGGGAAGAGGCCAAGATTAAAGGAAATGGAAATGCTACC
Translation
MSQGFRGPTG - UNI30277 - GVFPHQTQSYLDPSHEHSKWRYPQPQGPESYPRSFQLQQIEFLKGRLPEAPLIGIQTQSLPPFLPGHWPRFPGPPA

QDRQLEIWEFPRSVTLRNQGFHIGPPLPPPHSRGTPWRGADGLCSHFRELSISQSPEQKVLNRLEELGEGKATTAHVLARELRIPKRDINRILYSLEKKG

KLHRGRGKPPLWSLVPLSQAWTQPPGVVNPDSCIQEFPRGEPGLDSEDGDPASDLEGPSEPLDMAEIKEKICDYLFNVSNSSALNLAKNIGLTKARDVTS

VLIDLERQGDVYRQGATPPIWYLTDKKRERLQMKRSTHSAPAPTPTAVPEATRSPSFPACHPPPAGASSSVAASKRVENGQEPAIKHESRHEARPGPMRL

RPHAYHNGPSRAGYVASENGQWATDDIPDNLNSIHTAPGEFRAIMEMPSFYSPTLPRCSPYKKLTECQLKNPVSGLLEYAQFTSQTCDFNLIEQSGPSHE

PR RFKFQVVINGREFPPAEAGSKKVAKQDAAVKAMAILLREAKAKDSGQPEDLSHCPMEEDSEK PAEAQAPSSSATSLFSGKSPVTTLLECMHKLGNS

CEFRLLSKEGPAHDPK KFQYCVAVGAQTFPPVSAPSKKVAKQMAAEEAMKALQEEAASSADDQ SGGANTDSLDESMAPNKIRRIGELVRYLNTNPVGG

LLEYARSHGFAAEFKLIDQSGPPHEPK KFVYQAKVGGRWFPAVCAHSKKQGKQDAADAALRVLIGESEKAEQLGFAE LPLSGSTFHDQIAMLSHRCFN

ALTNSFQPSLLGRKILAAIIMKRDPEDMGVVVSLGTG GNRCVKGDSLSLKGETVNDCHAEIISRRGFIR RFLYSELMKYNHHTAKNSIFELARGGEKL

QIKKTVSFHLYIS STAPCGDGALFDKSCSDRAVESTESRHYPVFENPKQGKLRTKVENG GEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNV

LGLQGALLTHFLQPVYLKSVTLG GYLFSQGHLTRAICCRVTRDGKAFEDGLRYPFIVNHPK VGRVSVYDSKRQSGKTKETSVNWCMADGYDLEILDGT

RGTVDG GPGKELSRVSKKNIFLQFKKLCSFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEKNFYLCPVPND
Transcript ENSMUST00000107405
Sequence
GCCACAGGTGCGGGCCTTGCCGGCACTATGTCTCAAGGGTTCAGGGGACCCACAG - UNI30277 - GGGTGTTCCCTCACCAGACACAGTCGTACTT

GGACCCTAGTCATGAGCATAGCAAGTGGAGATACCCGCAGCCACAGGGGCCGGAGTCTTACCCTAGGAGTTTCCAGCTTCAGCAGATAGAGTTTCTCAAA

GGGCGGCTCCCAGAAGCACCCTTGATTGGAATACAAACCCAGTCACTGCCGCCATTCCTCCCAGGACACTGGCCAAGATTCCCAGGGCCACCTGCCCAAG

ACAGGCAACTGGAAATCTGGGAGTTCCCCAGGAGTGTGACTCTCAGAAATCAGGGGTTCCACATAGGACCCCCACTTCCTCCCCCACACAGCAGGGGTAC

ACCATGGAGAGGTGCTGACGGGCTTTGCTCACACTTCCGGGAGCTGAGCATCAGTCAGAGTCCGGAGCAGAAGGTTCTAAACCGCCTGGAAGAGCTTGGG

GAGGGGAAGGCCACCACTGCCCATGTGCTAGCCAGAGAGCTCAGAATCCCCAAAAGGGACATCAATCGTATTTTGTACTCCCTGGAAAAGAAGGGAAAGC

TGCACAGAGGAAGGGGGAAACCTCCTTTGTGGAGCCTTGTGCCCTTGAGTCAGGCTTGGACTCAGCCCCCTGGAGTTGTGAATCCAGATAGTTGTATCCA

GGAATTCCCTAGAGGAGAGCCTGGTTTGGACAGTGAGGACGGAGACCCTGCCTCTGACTTAGAAGGACCTTCTGAGCCTCTTGACATGGCTGAAATCAAG

GAGAAGATCTGTGACTATCTGTTCAATGTGTCAAACTCCTCTGCCCTGAACCTGGCTAAGAACATTGGCCTCACCAAGGCCCGAGATGTGACCTCAGTGC

TGATTGACTTGGAAAGGCAAGGCGATGTCTACAGGCAAGGGGCAACTCCTCCCATCTGGTACTTGACGGACAAGAAGCGTGAGAGGCTGCAGATGAAGAG

AAGTACACACAGTGCTCCTGCCCCTACCCCGACAGCTGTCCCAGAGGCCACTAGAAGCCCCTCATTCCCTGCCTGCCACCCGCCCCCAGCAGGTGCCTCA

AGCAGTGTGGCAGCCTCCAAGAGAGTGGAGAATGGGCAGGAGCCTGCGATAAAGCATGAAAGTAGGCATGAGGCCAGACCAGGACCAATGAGACTGCGGC

CTCACGCTTATCACAATGGCCCCTCTAGAGCAGGGTATGTGGCCTCTGAAAATGGCCAGTGGGCCACAGATGACATCCCAGATAACTTGAATAGTATCCA

CACAGCACCAGGTGAGTTTCGAGCCATCATGGAGATGCCCTCCTTCTACAGCCCTACCTTGCCACGGTGTTCACCCTACAAGAAGCTAACTGAGTGCCAG

CTGAAGAACCCTGTCAGCGGGTTGTTAGAGTATGCTCAGTTCACTAGTCAGACCTGTGATTTCAACCTGATAGAGCAGAGTGGACCGTCCCATGAACCTC

G ATTTAAATTCCAGGTTGTCATCAATGGGCGGGAATTTCCCCCAGCTGAGGCTGGCAGCAAGAAAGTAGCCAAGCAGGACGCAGCAGTGAAAGCCATGG

CGATTCTGCTTCGGGAAGCCAAAGCCAAAGACAGTGGTCAACCAGAAGACTTGTCCCACTGTCCCATGGAAGAAGACTCGGAGAAA CCAGCAGAGGCTC

AGGCCCCCAGCTCCTCAGCAACATCCTTGTTCTCTGGGAAGAGCCCAGTTACTACACTGCTTGAGTGCATGCACAAACTAGGGAACTCCTGTGAATTCCG

TCTCCTGTCCAAAGAAGGCCCTGCTCATGACCCCAA GTTCCAGTACTGTGTAGCAGTAGGAGCCCAGACCTTCCCCCCTGTGAGCGCCCCCAGCAAGAA

GGTAGCAAAGCAGATGGCCGCAGAGGAAGCCATGAAGGCGCTGCAGGAGGAGGCAGCCAGTTCAGCGGATGACCAG TCTGGAGGTGCGAACACAGACTC

ACTTGATGAATCTATGGCTCCCAACAAGATCAGGAGGATTGGTGAGCTCGTCAGGTACCTGAACACCAACCCCGTAGGCGGCTTGTTGGAGTACGCCCGA

TCTCATGGCTTTGCTGCTGAGTTCAAGCTCATTGACCAGTCTGGACCTCCTCACGAACCCAA GTTTGTTTACCAAGCAAAAGTTGGGGGCCGCTGGTTT

CCAGCCGTGTGTGCACACAGCAAGAAACAGGGCAAGCAGGATGCAGCGGATGCAGCCCTCCGGGTCTTGATCGGGGAGAGCGAGAAGGCAGAGCAGTTGG

GTTTCGCAGAGGTAACCCCAGTAACAGGGGCCAGTCTCAGAAGAACTATGCTCCTCCTTTCCAGGTCCCCAGATGCACATCCAAAGACA CTTCCTCTCT

CTGGCAGCACCTTCCACGACCAGATAGCTATGCTGAGCCACAGGTGCTTCAATGCTCTGACCAACAGTTTCCAGCCCTCCCTGCTCGGCCGCAAGATCCT

GGCTGCCATTATTATGAAAAGAGATCCAGAGGACATGGGTGTTGTCGTGAGTTTGGGGACAG GCAATCGCTGTGTGAAAGGGGACTCTCTCAGCCTGAA

GGGAGAGACGGTCAATGACTGCCATGCCGAAATCATCTCCCGGAGGGGCTTCATCAG GTTTCTCTACAGTGAACTGATGAAGTACAACCACCACACTGC

CAAGAACAGCATATTTGAGCTTGCCAGGGGAGGAGAGAAGCTGCAGATAAAGAAGACGGTTTCTTTTCATCTCTACATCAG CACGGCGCCATGTGGAGA

TGGGGCCCTCTTTGACAAATCCTGCAGTGACCGTGCCGTGGAAAGCACAGAGTCCCGCCATTACCCTGTCTTTGAAAATCCCAAGCAAGGCAAGCTTCGC

ACCAAGGTGGAGAATG GGGAAGGCACAATTCCTGTGGAGTCCAGTGATATTGTACCCACGTGGGATGGCATCCGCCTTGGGGAAAGACTCCGTACCATG

TCCTGTAGTGACAAAATCCTACGCTGGAATGTGCTGGGCCTGCAAGGGGCGTTGTTGACGCACTTCCTACAGCCTGTGTACCTGAAATCTGTAACCTTAG

 GTTACCTTTTCAGCCAAGGGCATCTGACCCGTGCTATTTGCTGCCGCGTGACCAGAGATGGGAAAGCATTTGAGGATGGACTACGCTATCCCTTTATTG

TCAACCACCCCAAG GTCGGCCGAGTCAGTGTTTATGATTCCAAAAGACAGTCCGGAAAGACCAAGGAAACAAGCGTCAACTGGTGCATGGCTGATGGCT

ATGACCTAGAGATCCTGGATGGCACCAGAGGCACTGTGGATGG ACCAGGGAAAGAGTTGTCTCGGGTGTCCAAGAAGAATATTTTCCTTCAGTTTAAGA

AGCTCTGCTCCTTCCGAGCCCGCAGAGATTTACTGCAGCTCTCTTATGGTGAAGCCAAGAAAGCTGCCCGTGACTATGACTTAGCCAAGAACTACTTCAA

GAAAAGCCTGCGAGACATGGGCTATGGGAATTGGATCAGCAAACCCCAGGAGGAAAAGAACTTTTACCTCTGTCCAGTACCCAATGACTGATAGTGGGGC

GCGTTTCTCCTGGGGTCAGAGGGCGGTCATGGCATTCCTCATCACACCGGGCCAGAGGATAGGAGCTTTTTTTACCCACTCCCCCCTTTTTTAATGGTAG

AACCATAATAGATGGTACCAAGAACTGCTTTCTTTGGGATTTCAAGGTGGGGTCCAGCCAAGTCCCCACCTCCCTTTTCTCAAGGGAAGAGGCCAAGATT

AAAGGAAATGGAAATGCTACC
Translation
MSQGFRGPTG - UNI30277 - GVFPHQTQSYLDPSHEHSKWRYPQPQGPESYPRSFQLQQIEFLKGRLPEAPLIGIQTQSLPPFLPGHWPRFPGPPA

QDRQLEIWEFPRSVTLRNQGFHIGPPLPPPHSRGTPWRGADGLCSHFRELSISQSPEQKVLNRLEELGEGKATTAHVLARELRIPKRDINRILYSLEKKG

KLHRGRGKPPLWSLVPLSQAWTQPPGVVNPDSCIQEFPRGEPGLDSEDGDPASDLEGPSEPLDMAEIKEKICDYLFNVSNSSALNLAKNIGLTKARDVTS

VLIDLERQGDVYRQGATPPIWYLTDKKRERLQMKRSTHSAPAPTPTAVPEATRSPSFPACHPPPAGASSSVAASKRVENGQEPAIKHESRHEARPGPMRL

RPHAYHNGPSRAGYVASENGQWATDDIPDNLNSIHTAPGEFRAIMEMPSFYSPTLPRCSPYKKLTECQLKNPVSGLLEYAQFTSQTCDFNLIEQSGPSHE

PR RFKFQVVINGREFPPAEAGSKKVAKQDAAVKAMAILLREAKAKDSGQPEDLSHCPMEEDSEK PAEAQAPSSSATSLFSGKSPVTTLLECMHKLGNS

CEFRLLSKEGPAHDPK KFQYCVAVGAQTFPPVSAPSKKVAKQMAAEEAMKALQEEAASSADDQ SGGANTDSLDESMAPNKIRRIGELVRYLNTNPVGG

LLEYARSHGFAAEFKLIDQSGPPHEPK KFVYQAKVGGRWFPAVCAHSKKQGKQDAADAALRVLIGESEKAEQLGFAEVTPVTGASLRRTMLLLSRSPDA

HPKT LPLSGSTFHDQIAMLSHRCFNALTNSFQPSLLGRKILAAIIMKRDPEDMGVVVSLGTG GNRCVKGDSLSLKGETVNDCHAEIISRRGFIR RFL

YSELMKYNHHTAKNSIFELARGGEKLQIKKTVSFHLYIS STAPCGDGALFDKSCSDRAVESTESRHYPVFENPKQGKLRTKVENG GEGTIPVESSDIV

PTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPVYLKSVTLG GYLFSQGHLTRAICCRVTRDGKAFEDGLRYPFIVNHPK VGRVSVYDSKR

QSGKTKETSVNWCMADGYDLEILDGTRGTVDG GPGKELSRVSKKNIFLQFKKLCSFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISK

PQEEKNFYLCPVPND

For any suggestions or comments, please send an email to unitrap@crg.es