Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027952 (Pmvk)
Chromosomal location
Chr 3: 89263122 - 89272928 (+)
Description
phosphomevalonate kinase Gene [Source:MGI (curated);Acc:Pmvk-001]
RefSeq_dna
NM_026784 
RefSeq_peptide
NP_081060.1 
UniGene
Mm.34242 
MGI
MGI:1915853 
Uniprot/SWISSPROT
Q9D1G2 
Uniprot/SPTREMBL
Q3THA3 
Human Ortholog
ENSG00000163344 (PMVK)
Omim not available
UniTrap UNI19672
Vector Insertion
Chr 3: 89265868 - 89268217
Public Clones not available
Private Clones OST383928 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34685
Vector Insertion
Chr 3: 89268371 - 89271468
Public Clones IST13240G3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20326
Vector Insertion
Chr 3: 89271603 - 89272759
Public Clones not available
Private Clones OST367210 (lexicon)
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107408
Sequence
ATGGCAGGAATTTATGGAATATTCTATGCCAG ACTTGGAGGTAACATCTGTGCTCTCCTGCGGCTCTCTGGTCCACTCAAGGAGGAGTATGCTCGG - 

UNI19672 - GAGCATGGCTTGGACTTCCAGAGACTTCTGGATGCGAGCACCTACAAGGAGACCTATCGGAGGGACATGATCTGTTGGGGGGAGCAGAA

GCGCCAGGCAGACCCAGGCTTCTTCTGCCGGAAGATTGTGGAAGGCGTGTCCCAGCCTATCTGG - UNI34685 - CTGGTGAGTGACACACGGAGGA

CATCTGACATCCAGTGGTTTCAGGAGGCCTATGGGGCTGTGATACAGACAGTCCGAGTAGTGGCCTCGGAGCAGAGTCGACAGCAACGGGGCTGGGTGTT

CACACCAG - UNI20326 - GGGTGGACGATGCTGAGTCAGAGTGTGGTCTGGACAACTTTGGGAACTTTGACTGGGTCATTGAGAACCACGGAGATG

AGCAGTGCCTGGAGGATCAGCTGGAGCACCTGCTGGGATTTATTCAAGCCAAACTTTAGTGATGAGGCTTGAGGGGACGAGCAGAGACTGATGGGCCTGG

CGAACAGTGGTTCTGCCAGATGTGGGTCCCCAGTCCCAGCCGAGGTCAGCAAACAGACAGACAGTCTGGCTTGCCAGAGGTCTGGGCAGGATGCTCGTGA

GTAGTGGGCAAATAAAGAAACCTCTGGTGTTGTGTTTTCCCTGGAGAGGACACTCTGCCTCTTTAGGGCACTTATAGGGCAAAGGCAGGCGCATGAGTTT

TGCCTGAGGCAGGAACATTGCCACACCCATGATGGGCAGGCTGCAGAGCTGTGATGGTGGTGTTTCCCTGTGTGTACGCTCTCAGCCCTGGAGTCCTAAT

AAACTTACTTGGATC
Translation
MAGIYGIFYAR RLGGNICALLRLSGPLKEEYAR - UNI19672 - EHGLDFQRLLDASTYKETYRRDMICWGEQKRQADPGFFCRKIVEGVSQPIW 

- UNI34685 - LVSDTRRTSDIQWFQEAYGAVIQTVRVVASEQSRQQRGWVFTPG - UNI20326 - GVDDAESECGLDNFGNFDWVIENHGDEQC

LEDQLEHLLGFIQAKL
Transcript ENSMUST00000029564
Sequence
AGTTTCTACGCCCATTCTCTGCGCGCTGGTTTCGATGTGGGCTGTGTAGTGTGGAGAAGGAGTGGGATCCCTCCTCCTTTTTGCTTCTACTGAGCGGGTC

CACTTCGTGCTTGGCTGCATTTCAGGGGTCCGAAGTGTCAGCTTTAGGCCTGGTGAAGCTTGGTGGCACCATGGCCCCGCTCGGAGCCTCCCCGCGTCTG

GTGCTGCTGTTTAGCGGGAAGAGAAAATCCGGGAAGGACTTCGTGACCGAGAGGCTGAAGAGCAG ACTTGGAGGTAACATCTGTGCTCTCCTGCGGCTC

TCTGGTCCACTCAAGGAGGAGTATGCTCGG - UNI19672 - GAGCATGGCTTGGACTTCCAGAGACTTCTGGATGCGAGCACCTACAAGGAGACCTA

TCGGAGGGACATGATCTGTTGGGGGGAGCAGAAGCGCCAGGCAGACCCAGGCTTCTTCTGCCGGAAGATTGTGGAAGGCGTGTCCCAGCCTATCTGG - 

UNI34685 - CTGGTGAGTGACACACGGAGGACATCTGACATCCAGTGGTTTCAGGAGGCCTATGGGGCTGTGATACAGACAGTCCGAGTAGTGGCCTC

GGAGCAGAGTCGACAGCAACGGGGCTGGGTGTTCACACCAG - UNI20326 - GGGTGGACGATGCTGAGTCAGAGTGTGGTCTGGACAACTTTGGGA

ACTTTGACTGGGTCATTGAGAACCACGGAGATGAGCAGTGCCTGGAGGATCAGCTGGAGCACCTGCTGGGATTTATTCAAGCCAAACTTTAGTGATGAGG

CTTGAGGGGACGAGCAGAGACTGATGGGCCTGGCGAACAGTGGTTCTGCCAGATGTGGGTCCCCAGTCCCAGCCGAGGTCAGCAAACAGACAGACAGTCT

GGCTTGCCAGAGGTCTGGGCAGGATGCTCGTGAGTAGTGGGCAAATAAAGAAACCTCTGGTGTTGTGTTTTCCCTGGAGAGGACACTCTGCCTCTTTAGG

GCACTTATAGGGCAAAGGCAGGCGCATGAGTTTTGCCTGAGGCAGGAACATTGCCACACCCATGATGGGCAGGCTGCAGAGCTGTGATGGTGGTGTTTCC

CTGTGTGTACGCTCTCAGCCCTGGAGTCCTAATAAACTTACTTGGATC
Translation
MAPLGASPRLVLLFSGKRKSGKDFVTERLKSR RLGGNICALLRLSGPLKEEYAR - UNI19672 - EHGLDFQRLLDASTYKETYRRDMICWGEQKR

QADPGFFCRKIVEGVSQPIW - UNI34685 - LVSDTRRTSDIQWFQEAYGAVIQTVRVVASEQSRQQRGWVFTPG - UNI20326 - GVDDAESE

CGLDNFGNFDWVIENHGDEQCLEDQLEHLLGFIQAKL
Transcript ENSMUST00000107410
Sequence
GAAGTGTCAGCTTTAGGCCTGGTGAAGCTTGGTGGCACCATGGCCCCGCTCGGAGCCTCCCCGCGTCTGGTGCTGCTGTTTAGCGGGAAGAGAAAATCCG

GGAAGGACTTCGTGACCGAGAGGCTGAAGAGCAG ACTTGGAGGTAACATCTGTGCTCTCCTGCGGCTCTCTGGTCCACTCAAGGAGGAGTATGCTCGG 

- UNI19672 - GAGCATGGCTTGGACTTCCAGAGACTTCTGGATGCGAGCACCTACAAGGAGACCTATCGGAGGGACATGATCTGTTGGGGGGAGCAG

AAGCGCCAGGCAGACCCAGGCTTCTTCTGCCGGAAGATTGTGGAAGGCGTGTCCCAGCCTATCTGG - UNI34685 - CTGGTGAGTGACACACGGAG

GACATCTGACATCCAGTGGTTTCAGGAGGCCTATGGGGCTGTGATACAGACAGTCCGAGTAGTGGCCTCGGAGCAGAGTCGACAGCAACGGGGCTGGGTG

TTCACACCAGGTAG - UNI20326 - AGGACACTCTGCCTCTTTAGGGCACTTATAGGGCAAAGGCAGGCGCATGAGTTTTGCCTGAGGCAGGAACAT

TGCCACACCCATGATGGGCAGGCTGCAGAGCTGTGATGGTGGTGTTTCCCTGTGTGTACGCTCTCAGCCCTGGAGTCCTAATAAACTTACTTGGA
Translation
MAPLGASPRLVLLFSGKRKSGKDFVTERLKSR RLGGNICALLRLSGPLKEEYAR - UNI19672 - EHGLDFQRLLDASTYKETYRRDMICWGEQKR

QADPGFFCRKIVEGVSQPIW - UNI34685 - LVSDTRRTSDIQWFQEAYGAVIQTVRVVASEQSRQQRGWVFTPGR - UNI20326 - RGHSASL

GHL

For any suggestions or comments, please send an email to unitrap@crg.es