Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000027958 (Hiat1)
Chromosomal location
Chr 3: 116334105 - 116365595 (-)
Description
hippocampus abundant gene transcript 1 Gene [Source:MGI (curated);Acc:Hiat1-001]
RefSeq_dna
NM_008246 
RefSeq_peptide
NP_032272.1 
UniGene
Mm.280077 
MGI
MGI:1201609 
Uniprot/SWISSPROT
P70187 
Uniprot/SPTREMBL
Q3TY74 
Human Ortholog
ENSG00000156875 (HIAT1)
Omim not available
UniTrap UNI1597
Vector Insertion
Chr 3: 116354418 - 116365312
Public Clones (sanger) CC0014 (sanger) M125G12 (ggtc) E045C11 (ggtc) P145H03 (ggtc)
E039D09 (ggtc) FHCRC-GT-S21-8A1 (fhcrc) IST14376D9 (tigm) IST10951G11 (tigm)
IST15058F5 (tigm) IST14266B10 (tigm)
Private Clones OST459596 (lexicon) OST431602 (lexicon) OST412803 (lexicon) OST362463 (lexicon)
OST360958 (lexicon) OST358355 (lexicon) OST358143 (lexicon) OST351931 (lexicon)
OST333439 (lexicon) OST298204 (lexicon) OST276427 (lexicon) OST266648 (lexicon)
OST266351 (lexicon) OST246210 (lexicon) OST230403 (lexicon) OST220628 (lexicon)
OST217003 (lexicon) OST195166 (lexicon) OST146522 (lexicon) OST143233 (lexicon)
OST135678 (lexicon) OST128296 (lexicon) OST116283 (lexicon) OST112418 (lexicon)
OST86351 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20834
Vector Insertion
Chr 3: 116351500 - 116354321
Public Clones not available
Private Clones OST350650 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21527
Vector Insertion
Chr 3: 116350828 - 116351436
Public Clones not available
Private Clones OST327098 (lexicon) OST313522 (lexicon) OST212505 (lexicon) OST200500 (lexicon)
OST188037 (lexicon) OST126697 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18518
Vector Insertion
Chr 3: 116344847 - 116348283
Public Clones not available
Private Clones OST421871 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18823
Vector Insertion
Chr 3: 116339309 - 116343304
Public Clones not available
Private Clones OST413585 (lexicon) OST413538 (lexicon)
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27072
Vector Insertion
Chr 3: 116337919 - 116339195
Public Clones not available
Private Clones OST73250 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27425
Vector Insertion
Chr 3: 116335399 - 116336639
Public Clones not available
Private Clones OST59812 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029570
Sequence
GTGGCTGCGTCACGGGGGCGTGGCGAGCGACTCAGCCGATCGCACGATGTGACGCGCCGCCCGAGGCAGGCCGGGCCCTCAAGATGGCGGCGTGCGCCCT

GAGCGGCTCGGCCCGGCAGTAGTGGCGGGACCGCACTCGCCGCTGGGGCCGCCCGCCCCCTGAGTGGCTGCTGCAGCGCCGGGAGTCGAGGATGGTAAAA

TGACCCAGGGGAAGAAAAAGAAACGGGCCGCGAACCGCAGTATCATGCTGGCCAAAAAGATCATCATTAAGGACGGAGGCACG - UNI1597 - CCTC

AAGGAATAGGCTCCCCTAGTGTGTATCATGCGGTTATTGTCATCTTTTTGGAGTTTTTTGCTTGGGGACTACTGACAGCACCCACATTGGTG - UNI20

834 - GTATTGCATGAAACCTTCCCTAAACATACATTTCTGATGAATGGCCTAATTCAAGGAGTAAAG - UNI21527 - GGTTTGTTGTCATTCCT

CAGTGCCCCACTTATTGGTGCTCTTTCTGATGTTTGGGGCCGAAAGTCCTTCCTGCTGCTAACAGTGTTTTTCACGTGTGCCCCTATTCCTCTGATGAAG

ATCAGCCCGTG GTGGTACTTTGCTGTTATCTCTGTTTCTGGGGTTTTTGCAGTAACCTTCTCTGTGGTATTTGCATATGTAGCAGATATAACTCAAGAG

CATGAAAGGAGTATGGCTTACGGACTG - UNI18518 - GTTTCTGCTACGTTCGCTGCCAGCTTAGTTACCAGCCCTGCAATTGGAGCTTACCTTGG

ACGAGTGTATGGGGACAGCTTAGTGGTGGTCCTTGCTACAGCAATAGCTCTGCTAGACATCTGTTTTATCCTTGTTGCTGTGCCAGAGTCATTGCCTGAG

AAGATGCGGCCAGCATCGTGGGGAGCTCCCATTTCATGGGAACAGGCTGACCCCTTTGCA TCTTTAAAAAAAGTGGGCCAAGACTCCATAGTGCTGCTG

ATCTGTATCACGGTGTTTCTCTCCTACCTACCTGAAGCCGGCCAGTACTCCAGCTTCTTCTTATACCTCAGACAG ATAATGAAATTTTCCCCAGAAAGT

GTGGCAGCCTTCATAGCAGTCCTTGGCATTCTGTCCATTATTGCACAG - UNI18823 - ACCATAGTCTTGAGTTTACTCATGAGGTCAATTGGAAA

TAAGAACACCATCTTACTGGGTCTGGGATTTCAAATATTGCAGCTGGCATGGTACGGCTTTGGTTCCGAACCTTG - UNI27072 - GATGATGTGGG

CTGCTGGGGCAGTGGCAGCCATGTCTAGCATCACCTTTCCAGCTGTTAGCGCCCTTGTTTCACGGACTGCTGACGCGGATCAACAGG GTGTTGTTCAAG

GGATGATAACAGGGATCAGAGGATTGTGCAATGGTCTGGGACCAGCCCTTTATGGGTTCATTTTCTACATATTCCATGTGGAACTTAAAGAACTGCCAAT

CACAGGGACAGACCTGGGGACAAACACAAGCCCTCAGCATCACTTTGAACAG - UNI27425 - AATTCCATCATCCCTGGTCCCCCTTTCCTCTTTG

GAGCCTGTTCGGTACTGCTGGCTCTGCTCGTTGCCTTGTTTATTCCGGAACACACTAATTTAAGTTTAAGGTCCAGCAGTTGGAGGAAGCACTGTGGCAG

TCACAGCCATCCTCACAGTACACAAGCGCCAGGAGAGGCCAAAGAACCTTTACTCCAGGACACGAATGTGTGACGGAAATCAGGAAGACTTCTCTCTCTC

GCAGCACCCAGGTCTTAGTTTTCACCTGTAGCTCTGGATGTACATTCCATTTCCATCTGCAGTGTACTTTAAGACTGTCTTAAGAAATACTTGCATGAAC

TCCGTGGGAACTAAAGAAAGAACCGGACAGTTTTCCAAAGATGTTACACTTTCTTTCAAAAAGAAACCTTTTGTTTATATTAGCACCACTCTCTTGCCAC

TAAACTGTTTTATTACACATCTTTAATTAAAGCTCTATCTGTAACTCCGTCTCTGCCATTTCCTTAGGTGTTGAGCCTTTACCTGCTCGTGCTGACTCAG

CGACACTAGGCAGGATGGTTATGGACCTGTTTGCTTTAACCTTGTAAAACCTGAGTCATTGTAAAATCTTGGGTCAAATAATTCAAAGCCTTAATGCAGA

TGCACTAGAAAAGAAATGGTAAAGAATTGTTTGCATTTAAAAGAACTTGTGAAAATTGTAGAAAACCAGAATCATGTTTCAAGCTTGTTTGCCATAATTT

TATTTAAAGCATTATTCACGGCTGTTCTGAAGAATGAAAAGATCAGCCACTTAGAATTCAAATTGGGGTGGTCAGAGCCTAGCCATCTGGCTCAATCTGT

TTAAATCTGTTCTGCTTCTTATACCACTATTCTTTTGATATTTGCATAATCATAAGGACCTCAACACTTGAATACATAATCTAAAAATTATATAGTAAAG

CTGGTAGCCTTGAAAATGTCAATGTGATATCTATATGTAGATAAATATATATAGTGGCCTTTCAGGACTGTCACAGTAACACTTTATTTACAGAGCTAAT

GTTTGTCCTAAATTTTCAGGACCCTAGAAGAGAGCTTTATACAATTACTGATGTGAATTTCTCTAAAGTGTATATTTTTGTGTCCAGTTATATTATTTAA

AAAAGTGTTACTTTGTAAAAATGTACATAAAGTATTGTATAGTTTACACTGTTTTCATCTTGTGTGTGGTTACTGCCTAATGCTTTTTAAACTTGGAGCA

TTCACTATGATTAAATAAGGTCTCAAATGTAAATATTCTGTTAATAAAATTAAATATTTT
Translation
MTQGKKKKRAANRSIMLAKKIIIKDGGT - UNI1597 - PQGIGSPSVYHAVIVIFLEFFAWGLLTAPTLV - UNI20834 - VLHETFPKHTFLM

NGLIQGVK - UNI21527 - GLLSFLSAPLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPW WWYFAVISVSGVFAVTFSVVFAYVADITQEHERS

MAYGL - UNI18518 - VSATFAASLVTSPAIGAYLGRVYGDSLVVVLATAIALLDICFILVAVPESLPEKMRPASWGAPISWEQADPFA SLKKVGQ

DSIVLLICITVFLSYLPEAGQYSSFFLYLRQ IMKFSPESVAAFIAVLGILSIIAQ - UNI18823 - TIVLSLLMRSIGNKNTILLGLGFQILQLAW

YGFGSEPW - UNI27072 - WMMWAAGAVAAMSSITFPAVSALVSRTADADQQG GVVQGMITGIRGLCNGLGPALYGFIFYIFHVELKELPITGTDL

GTNTSPQHHFEQ - UNI27425 - NSIIPGPPFLFGACSVLLALLVALFIPEHTNLSLRSSSWRKHCGSHSHPHSTQAPGEAKEPLLQDTNV

For any suggestions or comments, please send an email to unitrap@crg.es