Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028062 (Mapbpip)
Chromosomal location
Chr 3: 88353742 - 88356844 (-)
roadblock domain containing 3 Gene [Source:MGI (curated);Acc:Mapbpip-001]
Human Ortholog
ENSG00000116586 (ROBLD3)
UniTrap UNI13055
Vector Insertion
Chr 3: 88356440 - 88356651
Public Clones (sanger) CMHD-GT_342E5-3 (cmhd) CMHD-GT_365C6-3 (cmhd)
Private Clones OST401981 (lexicon) OST401980 (lexicon) OST313074 (lexicon) OST104275 (lexicon)
OST79537 (lexicon) OST36226 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12573
Vector Insertion
Chr 3: 88356276 - 88356440
Public Clones M058D07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16224
Vector Insertion
Chr 3: 88354708 - 88356276
Public Clones (ggtc) CMHD-GT_503B2-3 (cmhd) IST12457G8 (tigm) IST11918G2 (tigm)
IST10897C6 (tigm)
Private Clones OST464960 (lexicon) OST348671 (lexicon) OST217327 (lexicon) OST188691 (lexicon)
OST69121 (lexicon) OST57006 (lexicon) OST37280 (lexicon) OST26086 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13963
Vector Insertion
Chr 3: 88353927 - 88354617
Public Clones CMHD-GT_157E11-3 (cmhd)
Private Clones OST346020 (lexicon) OST326477 (lexicon) OST295025 (lexicon) OST284977 (lexicon)
OST256279 (lexicon) OST240162 (lexicon) OST188327 (lexicon) OST173065 (lexicon)
OST62163 (lexicon) OST53819 (lexicon) OST12773 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000119002






 - UNI12573 - - UNI13055 - MDCM - UNI12573 - - UNI16224 - EGRVAITRVANLLLCMYAKETVGFGMLKAK - UNI13963 

Transcript ENSMUST00000029698








For any suggestions or comments, please send an email to