Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028063 (Lmna)
Chromosomal location
Chr 3: 88285996 - 88307229 (-)
Description
lamin A Gene [Source:MGI (curated);Acc:Lmna-001]
RefSeq_dna
NM_019390 NM_001002011 
RefSeq_peptide
NP_001104572.1 NP_062263.1 NP_001002011.2 
UniGene
Mm.470666 
MGI
MGI:96794 
Uniprot/SWISSPROT
P48678 
Uniprot/SPTREMBL
B3RH24 Q3U733 Q3U7I5 Q3UCU3 Q9CTL2 B3RH23 Q8BNX5 
Human Ortholog
ENSG00000160789 (LMNA)
Omim 115200 - CARDIOMYOPATHY, DILATED, 1A  151660 - LIPODYSTROPHY, FAMILIAL PARTIAL, TYPE 2  159001 - MUSCULAR DYSTROPHY, LIMB-GIRDLE, TYPE 1B  176670 - HUTCHINSON-GILFORD PROGERIA SYNDROME  181350 - EMERY-DREIFUSS MUSCULAR DYSTROPHY, AUTOSOMAL DOMINANT  248370 - MANDIBULOACRAL DYSPLASIA WITH TYPE A LIPODYSTROPHY  275210 - TIGHT SKIN CONTRACTURE SYNDROME, LETHAL  277700 - WERNER SYNDROME  604929 - EMERY-DREIFUSS MUSCULAR DYSTROPHY, AUTOSOMAL RECESSIVE  605588 - CHARCOT-MARIE-TOOTH DISEASE, AXONAL, TYPE 2B1  607554 - ATRIAL FIBRILLATION, FAMILIAL, 3  607920 -  608056 - LIPOATROPHY WITH DIABETES, HEPATIC STEATOSIS, HYPERTROPHIC CARDIOMYOPATHY,  611618 - ARTHROPATHY, TENDINOUS CALCINOSIS, AND PROGEROID FEATURES  
UniTrap UNI10494
Vector Insertion
Chr 3: 88297235 - 88306669
Public Clones D020A09 (ggtc) M073F03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33032
Vector Insertion
Chr 3: 88297158 - 88307230
Public Clones (ggtc) PST17598-NR (escells) IST10770B5 (tigm) IST11875A8 (tigm)
IST10762H12 (tigm) IST11747A10 (tigm) IST10502H4 (tigm) IST10496A7 (tigm)
IST13926C11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25496
Vector Insertion
Chr 3: 88292354 - 88297158
Public Clones CMHD-GT_536A4-5S (cmhd) IST12304C10 (tigm) IST12304B8 (tigm) IST13499A9 (tigm)
IST14626B3 (tigm) IST12783A1 (tigm) IST12566H6 (tigm) IST14481F1 (tigm)
Private Clones OST181306 (lexicon) OST169201 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14233
Vector Insertion
Chr 3: 88290729 - 88292354
Public Clones CMHD-GT_472E8-3 (cmhd) CMHD-GT_511H10-3 (cmhd) CMHD-GT_504B9-3 (cmhd) FHCRC-GT-S7-1F1 (fhcrc)
FHCRC-GT-S22-2D1 (fhcrc) FHCRC-GT-S23-2D1 (fhcrc)
Private Clones OST389845 (lexicon) OST369692 (lexicon) OST146025 (lexicon) OST102690 (lexicon)
OST61021 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32565
Vector Insertion
Chr 3: 88287968 - 88288760
Public Clones IST12278A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120377
Sequence
AGTGTTCGCGGGAACGCTGCCTCAGCCTCAACACCAGCCAACCCAGATCCCGAGGTGCGCCAGCGCCCAGCCCAGATCTCCACGCCTGCCAGGAGCGAGC

TTCGCCGGCTCGCTGTCCCCCTGAGCAGCCTCTGTCCTTCTGTCCAAGTCCCGCGCCCTTCTCGGGACCCCTGCCCAGCGGGCAGCACTGTCACCCTGCC

GGCCATGGAGACCCCGTCACAGCGGCGCGCCACCCGCAGTGGGGCGCAGGCCAGCTCTACCCCACTGTCGCCCACTCGGATCACCCGGCTGCAGGAGAAG

GAGGACCTGCAGGAGCTCAATGACCGCCTGGCCGTGTACATCGATCGCGTGCGTTCCCTGGAGACCGAGAACGCGGGGCTGCGCCTTCGCATCACTGAGT

CTGAAGAGGTGGTCAGCCGAGAGGTGTCCGGCATCAAGGCGGCCTACGAGGCCGAGCTGGGGGATGCCCGCAAGACCCTTGATTCTGTGGCCAAGGAGCG

CGCCCGCCTCCAGCTAGAGCTGAGCAAAGTGCGTGAGGAGTTCAAGGAGCTGAAGGCTCG - UNI10494 - - UNI14233 - - UNI25496 - 

- UNI33032 - CAACACCAAGAAGGAGGGGGACTTGTTGGCTGCGCAGGCCCGGCTCAAGGACCTCGAGGCTCTTCTCAACTCCAAGGAAGCTGCCCT

GAGCACTGCTCTCAGTGAGAAGCGCACATTGGAGGGCGAGCTCCATGACCTGCGGGGGCAGGTAGCCAAG - UNI14233 - CTTGAGGCGGCCCTGG

GAGAGGCTAAGAAGCAGCTTCAGGATGAGATGCTGAGGCGAGTGGATGCTGAGAACAGGCTACAGACGCTGAAGGAGGAGCTTGACTTCCAGAAGAACAT

TTACAGCGAG - UNI14233 - GAACTGCGTGAGACCAAGCGCCGGCATGAGACGCGGCTTGTGGAGATCGATAACGGGAAGCAGCGAGAGTTTGAGA

GCCGGCTGGCAGATGCCCTGCAGGAGCTGCGGGCTCAGCATGAGGACCAGGTGGAACAGTATAAGAAGGAGCTAGAAAAGACATACTCCGCCAAG CTGG

ATAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTCGTGGGGGCTGCCCATGAGGAACTGCAGCAGTCTCGAATCCGCATTGACAGCCTCTCGGCCCA

GCTCAGCCAGCTCCAAAAGCAG TTGGCAGCCAAGGAGGCAAAGCTGCGTGACCTGGAGGACTCGCTGGCCCGTGAGCGCGATACCAGCCGGCGCCTGCT

GGCTGAGAAAGAGCGAGAGATGGCGGAGATGCGGGCGAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTGCTGGACATCAAGCTGGCCCTGGACATG

GAGATCCATGCCTATCGAAAGCTGCTGGAGGGCGAGGAGGAGAG - UNI32565 - GCTGCGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGG

CCGCGCCTCCTCCCACTCATCCCAGTCTCAGGGTGGAGGCAGCGTCACCAAAAAGCGCAAGCTGGAGTCTTCCGAGAGCCGGAGCAGCTTCTCGCAGCAT

GCTCGCACTAGCGGGCGTGTGGCGGTAGAGGAAGTCGATGAAGAGGGAAAGTTCGTGCGGCTGCGCAACAAGTCCAACGAG - UNI32565 - GACCA

GTCCATGGGCAACTGGCAGATCAGGCGTCAGAATGGTGACGATCCTTTGATGACCTATCGCTTCCCACCGAAGTTCACCCTAAAGGCTGGGCAGGTGGTG

ACG - UNI32565 - ATCTGGGCTTCAGGAGCTGGGGCCACCCATAGCCCCCCTACTGACTTGGTGTGGAAGGCGCAGAACACCTGGGGCTGTGGGAG

CAGCCTTCGCACCGCTCTCATCAACTCCACTGGAGAA GAAGTGGCCATGCGCAAGCTGGTGCGCTCACTGACCATGGTTGAGGACAATGAGGATGACGA

CGAGGATGGAGAAGAGCTCCTCCATCACCACCGTGTGAGTGGCAGCCGCCGCTGAGGCCCAGCCCACAAGGGTAGCCCTGCCAGCCTAGGGCAGCTCTCC

CACCTCCATGCCAAAGTCTTTTCATTAAAGAATGTTTTGGAATGCCA
Translation
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERA

RLQLELSKVREEFKELKAR - UNI10494 - - UNI14233 - - UNI25496 - - UNI33032 - RNTKKEGDLLAAQARLKDLEALLNSKEA

ALSTALSEKRTLEGELHDLRGQVAK - UNI14233 - LEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSE - UNI14233 - ELRET

KRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAK LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQ LAAK

EAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEER - UNI32565 - RLRLSPSPTSQRSRGR

ASSHSSQSQGGGSVTKKRKLESSESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNE - UNI32565 - DQSMGNWQIRRQNGDDPLMTYRFPPKF

TLKAGQVVT - UNI32565 - IWASGAGATHSPPTDLVWKAQNTWGCGSSLRTALINSTGE EVAMRKLVRSLTMVEDNEDDDEDGEELLHHHRVSGS

RR
Transcript ENSMUST00000036252
Sequence
ACCGGGTCTTTCCGGAACTCCTGAGGGCGCAAGGCCTTGCTCTCTCTGGCCCAGCCATGGGGAACGCGGAGGGCCG - UNI14233 - - UNI25496

 - - UNI33032 - CAACACCAAGAAGGAGGGGGACTTGTTGGCTGCGCAGGCCCGGCTCAAGGACCTCGAGGCTCTTCTCAACTCCAAGGAAGCTGC

CCTGAGCACTGCTCTCAGTGAGAAGCGCACATTGGAGGGCGAGCTCCATGACCTGCGGGGGCAGGTAGCCAAG - UNI14233 - CTTGAGGCGGCCC

TGGGAGAGGCTAAGAAGCAGCTTCAGGATGAGATGCTGAGGCGAGTGGATGCTGAGAACAGGCTACAGACGCTGAAGGAGGAGCTTGACTTCCAGAAGAA

CATTTACAGCGAG - UNI14233 - GAACTGCGTGAGACCAAGCGCCGGCATGAGACGCGGCTTGTGGAGATCGATAACGGGAAGCAGCGAGAGTTTG

AGAGCCGGCTGGCAGATGCCCTGCAGGAGCTGCGGGCTCAGCATGAGGACCAGGTGGAACAGTATAAGAAGGAGCTAGAAAAGACATACTCCGCCAAG C

TGGATAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTCGTGGGGGCTGCCCATGAGGAACTGCAGCAGTCTCGAATCCGCATTGACAGCCTCTCGGC

CCAGCTCAGCCAGCTCCAAAAGCAG TTGGCAGCCAAGGAGGCAAAGCTGCGTGACCTGGAGGACTCGCTGGCCCGTGAGCGCGATACCAGCCGGCGCCT

GCTGGCTGAGAAAGAGCGAGAGATGGCGGAGATGCGGGCGAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTGCTGGACATCAAGCTGGCCCTGGAC

ATGGAGATCCATGCCTATCGAAAGCTGCTGGAGGGCGAGGAGGAGAG - UNI32565 - GCTGCGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCG

TGGCCGCGCCTCCTCCCACTCATCCCAGTCTCAGGGTGGAGGCAGCGTCACCAAAAAGCGCAAGCTGGAGTCTTCCGAGAGCCGGAGCAGCTTCTCGCAG

CATGCTCGCACTAGCGGGCGTGTGGCGGTAGAGGAAGTCGATGAAGAGGGAAAGTTCGTGCGGCTGCGCAACAAGTCCAACGAG - UNI32565 - GA

CCAGTCCATGGGCAACTGGCAGATCAGGCGTCAGAATGGTGACGATCCTTTGATGACCTATCGCTTCCCACCGAAGTTCACCCTAAAGGCTGGGCAGGTG

GTGACG - UNI32565 - ATCTGGGCTTCAGGAGCTGGGGCCACCCATAGCCCCCCTACTGACTTGGTGTGGAAGGCGCAGAACACCTGGGGCTGTGG

GAGCAGCCTTCGCACCGCTCTCATCAACTCCACTGGAGAA GAAGTGGCCATGCGCAAGCTGGTGCGCTCACTGACCATGGTTGAGGACAATGAGGATGA

CGACGAGGATGGAGAAGAGCTCCTCCATCACCACCGTGTGAGTGGCAGCCGCCGCTGAGGCCCAGCCCACAAGGGTAGCCCTGCCAGCCTAGGGCAGCTC

TCCCACCTCCATGCCAAAGTCTTTTCATTAAAGAATGTTTTGGAATGCC
Translation
MGNAEGR - UNI14233 - - UNI25496 - - UNI33032 - RNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAK

 - UNI14233 - LEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSE - UNI14233 - ELRETKRRHETRLVEIDNGKQREFESRLAD

ALQELRAQHEDQVEQYKKELEKTYSAK LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQ LAAKEAKLRDLEDSLARERDTSRRLLAEK

EREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEER - UNI32565 - RLRLSPSPTSQRSRGRASSHSSQSQGGGSVTKKRKLESSES

RSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNE - UNI32565 - DQSMGNWQIRRQNGDDPLMTYRFPPKFTLKAGQVVT - UNI32565 - IW

ASGAGATHSPPTDLVWKAQNTWGCGSSLRTALINSTGE EVAMRKLVRSLTMVEDNEDDDEDGEELLHHHRVSGSRR
Transcript ENSMUST00000029699
Sequence
AGTGTTCGCGGGAACGCTGCCTCAGCCTCAACACCAGCCAACCCAGATCCCGAGGTGCGCCAGCGCCCAGCCCAGATCTCCACGCCTGCCAGGAGCGAGC

TTCGCCGGCTCGCTGTCCCCCTGAGCAGCCTCTGTCCTTCTGTCCAAGTCCCGCGCCCTTCTCGGGACCCCTGCCCAGCGGGCAGCACTGTCACCCTGCC

GGCCATGGAGACCCCGTCACAGCGGCGCGCCACCCGCAGTGGGGCGCAGGCCAGCTCTACCCCACTGTCGCCCACTCGGATCACCCGGCTGCAGGAGAAG

GAGGACCTGCAGGAGCTCAATGACCGCCTGGCCGTGTACATCGATCGCGTGCGTTCCCTGGAGACCGAGAACGCGGGGCTGCGCCTTCGCATCACTGAGT

CTGAAGAGGTGGTCAGCCGAGAGGTGTCCGGCATCAAGGCGGCCTACGAGGCCGAGCTGGGGGATGCCCGCAAGACCCTTGATTCTGTGGCCAAGGAGCG

CGCCCGCCTCCAGCTAGAGCTGAGCAAAGTGCGTGAGGAGTTCAAGGAGCTGAAGGCTCG - UNI10494 - - UNI14233 - - UNI25496 - 

- UNI33032 - CAACACCAAGAAGGAGGGGGACTTGTTGGCTGCGCAGGCCCGGCTCAAGGACCTCGAGGCTCTTCTCAACTCCAAGGAAGCTGCCCT

GAGCACTGCTCTCAGTGAGAAGCGCACATTGGAGGGCGAGCTCCATGACCTGCGGGGGCAGGTAGCCAAG - UNI14233 - CTTGAGGCGGCCCTGG

GAGAGGCTAAGAAGCAGCTTCAGGATGAGATGCTGAGGCGAGTGGATGCTGAGAACAGGCTACAGACGCTGAAGGAGGAGCTTGACTTCCAGAAGAACAT

TTACAGCGAG - UNI14233 - GAACTGCGTGAGACCAAGCGCCGGCATGAGACGCGGCTTGTGGAGATCGATAACGGGAAGCAGCGAGAGTTTGAGA

GCCGGCTGGCAGATGCCCTGCAGGAGCTGCGGGCTCAGCATGAGGACCAGGTGGAACAGTATAAGAAGGAGCTAGAAAAGACATACTCCGCCAAG CTGG

ATAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTCGTGGGGGCTGCCCATGAGGAACTGCAGCAGTCTCGAATCCGCATTGACAGCCTCTCGGCCCA

GCTCAGCCAGCTCCAAAAGCAG TTGGCAGCCAAGGAGGCAAAGCTGCGTGACCTGGAGGACTCGCTGGCCCGTGAGCGCGATACCAGCCGGCGCCTGCT

GGCTGAGAAAGAGCGAGAGATGGCGGAGATGCGGGCGAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTGCTGGACATCAAGCTGGCCCTGGACATG

GAGATCCATGCCTATCGAAAGCTGCTGGAGGGCGAGGAGGAGAG - UNI32565 - GCTGCGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGG

CCGCGCCTCCTCCCACTCATCCCAGTCTCAGGGTGGAGGCAGCGTCACCAAAAAGCGCAAGCTGGAGTCTTCCGAGAGCCGGAGCAGCTTCTCGCAGCAT

GCTCGCACTAGCGGGCGTGTGGCGGTAGAGGAAGTCGATGAAGAGGGAAAGTTCGTGCGGCTGCGCAACAAGTCCAACGAG - UNI32565 - GACCA

GTCCATGGGCAACTGGCAGATCAGGCGTCAGAATGGTGACGATCCTTTGATGACCTATCGCTTCCCACCGAAGTTCACCCTAAAGGCTGGGCAGGTGGTG

ACG - UNI32565 - ATCTGGGCTTCAGGAGCTGGGGCCACCCATAGCCCCCCTACTGACTTGGTGTGGAAGGCGCAGAACACCTGGGGCTGTGGGAG

CAGCCTTCGCACCGCTCTCATCAACTCCACTGGAGAA GAAGTGGCCATGCGCAAGCTGGTGCGCTCACTGACCATGGTTGAGGACAATGAGGATGACGA

CGAGGATGGAGAAGAGCTCCTCCATCACCACCGT GGTTCCCACTGCAGCGGCTCGGGGGACCCCGCTGAGTACAACCTGCGCTCACGCACCGTGCTGTG

CGGGACGTGTGGGCAGCCTGCTGACAAGGCTGCCGGTGGAGCGGGAGCCCAGGTGGGCGGATCCATCTCCTCTGGCTCTTCTGCCTCCAGTGTCACAGTC

ACTCGAAGCTTCCGCAGTGTGGGGGGCAGTGGGGGTGGCAGCTTCGGGGACAACCTAGTCACCCGCTCCTACCTCCTGGGCAACTCCAGTCCCCGGAGCC

AG AGCTCCCAGAACTGCAGCATCATGTAA
Translation
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERA

RLQLELSKVREEFKELKAR - UNI10494 - - UNI14233 - - UNI25496 - - UNI33032 - RNTKKEGDLLAAQARLKDLEALLNSKEA

ALSTALSEKRTLEGELHDLRGQVAK - UNI14233 - LEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSE - UNI14233 - ELRET

KRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAK LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQ LAAK

EAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEER - UNI32565 - RLRLSPSPTSQRSRGR

ASSHSSQSQGGGSVTKKRKLESSESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNE - UNI32565 - DQSMGNWQIRRQNGDDPLMTYRFPPKF

TLKAGQVVT - UNI32565 - IWASGAGATHSPPTDLVWKAQNTWGCGSSLRTALINSTGE EVAMRKLVRSLTMVEDNEDDDEDGEELLHHHR GSH

CSGSGDPAEYNLRSRTVLCGTCGQPADKAAGGAGAQVGGSISSGSSASSVTVTRSFRSVGGSGGGSFGDNLVTRSYLLGNSSPRSQ SSQNCSIM

For any suggestions or comments, please send an email to unitrap@crg.es