Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028064 (Sema4a)
Chromosomal location
Chr 3: 88239884 - 88259674 (-)
Description
sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A Gene [Source:MGI (curated);Acc:Sema4a-001]
RefSeq_dna
NM_013658 
RefSeq_peptide
NP_038686.2 
UniGene
Mm.439752 Mm.468952 
MGI
MGI:107560 
Uniprot/SWISSPROT
Q62178 
Human Ortholog
ENSG00000196189 (SEMA4A)
Omim 610282 - RETINITIS PIGMENTOSA 35  610283 - CONE-ROD DYSTROPHY 10  
UniTrap UNI35927
Vector Insertion
Chr 3: 88251912 - 88253775
Public Clones IST14241A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31775
Vector Insertion
Chr 3: 88244619 - 88252064
Public Clones IST14937D7 (tigm) IST14105C12 (tigm) IST12780A5 (tigm) IST14937D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23767
Vector Insertion
Chr 3: 88242484 - 88244619
Public Clones IST14294B7 (tigm)
Private Clones OST245642 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19362
Vector Insertion
Chr 3: 88242263 - 88242364
Public Clones not available
Private Clones OST393408 (lexicon) OST280536 (lexicon)
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33995
Vector Insertion
Chr 3: 88239887 - 88241823
Public Clones IST14885E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107531
Sequence
CTGGCTCTGGCAGGATGGGTGCCTGGAGGGCCGCGCGCCCGTTCCAGCCAGGCTGAGCCTGCTTGCCTTGCCTGGACCCCCTTCTTTGCCTCGGATGGCA

CCCTGATTCAGGGTTTGAACACAGGACTTCTCAGTGTGGCTGGCTCAAGGGTAT GAGACGGGCACAGGGCCCTCAGCTTCTTCCAACAAAAAGGCCTCC

GAGACTTTGACACGCTGCTCCTGAGTGACGATGGCAACACTCTCTATGTGGGGGCTCGAGAGGCCGTCCTGGCCTTGAATATCCAGAACCCAGGAATCCC

AAGGCTAAAGAACATG ATACCCTGGCCAGCCAGTGAGAGAAAAAAGACCGAATGTGCCTTTAAGAAGAAGAGCAATGAG GAACTCCAAGATTCCCTCC

TGTTGCCCATCTTGATAGACAAGGTCATGGACGGGAAGGGCCAAAGCCCCTTTGACCCTGTTCACAAGCACACAGCTGTCTTGGTCG ATGGGATGCTTT

ATTCCGGCACCATGAACAACTTCCTGGGCAGCGAGCCCATCCTGATGCGGACACTGGGATCCCAGCCTGTTCTCAAGACTGACATCTTCTTACGCTGGCT

GCACG CGGATGCCTCCTTCGTGGCAGCCATTCCATCCACCCAGGTCGTCTATTTCTTCTTTGAGGAGACAGCCAGCGAGTTTGACTTCTTTGAAGAGCT

GTATATATCCAGGGTGGCTCAAGTCTGCAAG - UNI35927 - AACGACGTGGGCGGTGAAAAGCTGCTGCAGAAGAAGTGGACCACCTTCCTCAAAG

CCCAGTTGCTCTGCGCTCAGCCAGGGCAGCTGCCATTCAACATCATCCGCCACGCGGTCCTGCTGCCCGCCGATTCTCCCTCTGTTTCCCGCATCTACGC

AGTCTTTACCTCCCAGTG - UNI31775 - - UNI35927 - GCAGGTTGGCGGGACCAGGAGCTCAGCAGTCTGTGCCTTCTCTCTCACGGACATT

GAGCGAGTCTTTAAAGGGAAGTACAAGGAGCTGAACAAGGAGACCTCCCGCTGGACCACTTACCGGGGCTCAGAGGTCAGCCCGAGGCCAGGCAGT - U

NI31775 - - UNI35927 - TGCTCCATGGGCCCCTCCTCTGACAAAGCCTTGACCTTCATGAAGGACCATTTTCTGATGGATGAGCACGTGGTAGG

AACACCCCTGCTGGTGAAGTCTGGTGTGGAGTACACACGGCTTGCTGTGGAGTCAGCTCGGGGCCTTGATGGGAGCAGCCATGTGGTCATGTATCTGGGT

ACCT - UNI23767 - - UNI31775 - CCACGGGGTCCCTGCACAAGGCTGTGGTGCCTCAGGACAGCAGTGCTTATCTCGTGGAGGAGATTCAGC

TGAGCCCTGACTCTGAGCCTGTTCGAAACCTGCAGCTGGCCCCCGCCCAG - UNI19362 - GGTGCAGTGTTTGCAGGCTTCTCTGGAGGCATCTGG

AGAGTTCCCAGGGCCAATTGCAGTGTCTACGAGAGCTGTGTGGACTGTGTGCTTGCCAGGGACCCTCACTGTGCCTGGGACCCTGAATCAAGACTCTGCA

GCCTTCTGTCTGGCTCTACCAA - UNI33995 - GCCTTGGAAGCAGGACATGGAACGCGGCAACCCGGAGTGGGTATGCACCCGTGGCCCCATGGCC

AGGAGCCCCCGGCGTCAGAGCCCCCCTCAACTAA - UNI33995 - TTAAAGAAGTCCTGACAGTCCCCAACTCCATCCTGGAGCTGCCCTGCCCCCA

CCTGTCAGCACTGGCCTCTTACCACTGGAGTCATGGCCGAGCCAAAATCTCAGAAGCCTCTGCTACCGTCTACAATGGCTCCCTCTTGCTGCTGCCGCAG

GATGGTGTCGGGGGCCTCTACCAGTGTGTGGCGACTGAGAACGGCTACTCATACCCTGTGGTCTCCTATTGGGTAGACAGCCAGGACCAGCCCCTGGCGC

TGGACCCTGAGCTGGCGGGCGTTCCCCGTGAGCGTGTGCAGGTCCCGCTGACCAGGGTCGGAGGCGGAGCTTCCATGGCTGCCCAGCGGTCCTACTGGCC

CCATTTTCTCATCGTTACCGTCCTCCTGGCCATCGTGCTCCTGGGAGTGCTCACTCTCCTCCTCGCTTCCCCACTGGGGGCGCTGCGGGCTCGGGGTAAG

GTTCAGGGCTGTGGGATGCTGCCCCCCAGGGAAAAGGCTCCACTGAGCAGGGACCAGCACCTCCAGCCCTCCAAGGACCACAGGACCTCTGCCAGTGACG

TAGATGCCGACAACAACCATCTGGGCGCCGAAGTGGCTTAAACAGGGACACAGATCCGCAGCTGAGCAGAGCAAGCCACTGGCCTTGTTGGCTATGCCAG

GCACAGTGCCACTCTGACCAGGGTAGGAGGCTCTCCTGCTAACGTGTGTCACCTACAGCACCCAGTAGGTCCTCCCCTGTGGGACTCTCTTCTGCAAGCA

CATTGGGCTGTCTCCATACCTGTACTTGTGCTGTGACAGGAAGAGCCAGACAGGTTTCTTTGATTTTGATTGACCCAAGAGCCCTCCTGTAACAAACGTG

CTCCAGGAGACCATGAAAGGTGTGGCTGTCTGGGATTCTGTGGTGACAAACCTAAGCATCCGAGCAAGCTGGGGCTATTCCTGCAAACTCCATCCTGAAC

GCTGTCACTCTAGAAGCAGCTGCTGCTTTGAACACCAGCCCACCCTCCTTCCCAAGAGTCTCTATGGAGTTGGCCCCTTGTGTTTCCTTTACCAGTCATG

CCATACTGTTTGGGAAGTCATCTCTGAAGTCTAACCACCTTCCTTCTTGCTTCAGTTTGGACAGATTGTTATTATTGTCTCTGCCCTGGCTAGAATGGGG

GGCATAATCTGAGCCTTGTTCCCTTGTCCAGTGTGGCTGACCCTTGACCTCTTCCTTCCTCCTCCCTTTGTTTTGGGATTCAGAAAACTGCTTGTCACAG

ACAATTTATTTTTTATTAAAAAAGATATAAGCTTTAAAG
Translation
 M IPWPASERKKTECAFKKKSNE ELQDSLLLPILIDKVMDGKGQSPFDPVHKHTAVLVD DGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDIFLRWL

HA ADASFVAAIPSTQVVYFFFEETASEFDFFEELYISRVAQVCK - UNI35927 - NDVGGEKLLQKKWTTFLKAQLLCAQPGQLPFNIIRHAVLLP

ADSPSVSRIYAVFTSQW - UNI31775 - - UNI35927 - WQVGGTRSSAVCAFSLTDIERVFKGKYKELNKETSRWTTYRGSEVSPRPGS - UN

I31775 - - UNI35927 - CSMGPSSDKALTFMKDHFLMDEHVVGTPLLVKSGVEYTRLAVESARGLDGSSHVVMYLGTS - UNI23767 - - U

NI31775 - STGSLHKAVVPQDSSAYLVEEIQLSPDSEPVRNLQLAPAQ - UNI19362 - GAVFAGFSGGIWRVPRANCSVYESCVDCVLARDPHC

AWDPESRLCSLLSGSTK - UNI33995 - KPWKQDMERGNPEWVCTRGPMARSPRRQSPPQLI - UNI33995 - IKEVLTVPNSILELPCPHLSA

LASYHWSHGRAKISEASATVYNGSLLLLPQDGVGGLYQCVATENGYSYPVVSYWVDSQDQPLALDPELAGVPRERVQVPLTRVGGGASMAAQRSYWPHFL

IVTVLLAIVLLGVLTLLLASPLGALRARGKVQGCGMLPPREKAPLSRDQHLQPSKDHRTSASDVDADNNHLGAEVA
Transcript ENSMUST00000029700
Sequence
AGGATCTGTCACAACTCGAGGTAGAAATTCTGGTTTCCCTGGCCTGAAACCCACACTGGCTCTGGCAGGATGGGTGCCTGGAGGGCCGCGCGCCCGTTCC

AGCCAGGCTGAGCCTGCTTGCCTTGCCTGGACCCCCTTCTTTGCCTCGGATGGCACCCTGATTCAGGGTTTGAACACAGGACTTCTCAGTGTGGCTGGCT

CAAGG AACCATCTGGTGACCATCTCAGGCTGACCATGGCCCTACCATCCCTGGGCCAGGACTCATGGAGTCTCCTGCGTGTTTTTTTCTTCCAACTCTT

CCTGCTGCCATCACTGCCACCTGCTTCTGGGACTGGTGGTCAGGGGCCCATGCCCAGAGTCAAATACCATGCTG GAGACGGGCACAGGGCCCTCAGCTT

CTTCCAACAAAAAGGCCTCCGAGACTTTGACACGCTGCTCCTGAGTGACGATGGCAACACTCTCTATGTGGGGGCTCGAGAGGCCGTCCTGGCCTTGAAT

ATCCAGAACCCAGGAATCCCAAGGCTAAAGAACATG ATACCCTGGCCAGCCAGTGAGAGAAAAAAGACCGAATGTGCCTTTAAGAAGAAGAGCAATGAG

 ACACAGTGTTTCAACTTCATTCGAGTCCTGGTCTCTTACAATGCTACTCACCTCTATGCCTGTGGGACCTTTGCCTTCAGCCCTGCCTGTACCTTCATT

 GAACTCCAAGATTCCCTCCTGTTGCCCATCTTGATAGACAAGGTCATGGACGGGAAGGGCCAAAGCCCCTTTGACCCTGTTCACAAGCACACAGCTGTC

TTGGTCG ATGGGATGCTTTATTCCGGCACCATGAACAACTTCCTGGGCAGCGAGCCCATCCTGATGCGGACACTGGGATCCCAGCCTGTTCTCAAGACT

GACATCTTCTTACGCTGGCTGCACG CGGATGCCTCCTTCGTGGCAGCCATTCCATCCACCCAGGTCGTCTATTTCTTCTTTGAGGAGACAGCCAGCGAG

TTTGACTTCTTTGAAGAGCTGTATATATCCAGGGTGGCTCAAGTCTGCAAG - UNI35927 - AACGACGTGGGCGGTGAAAAGCTGCTGCAGAAGAA

GTGGACCACCTTCCTCAAAGCCCAGTTGCTCTGCGCTCAGCCAGGGCAGCTGCCATTCAACATCATCCGCCACGCGGTCCTGCTGCCCGCCGATTCTCCC

TCTGTTTCCCGCATCTACGCAGTCTTTACCTCCCAGTG - UNI31775 - - UNI35927 - GCAGGTTGGCGGGACCAGGAGCTCAGCAGTCTGTG

CCTTCTCTCTCACGGACATTGAGCGAGTCTTTAAAGGGAAGTACAAGGAGCTGAACAAGGAGACCTCCCGCTGGACCACTTACCGGGGCTCAGAGGTCAG

CCCGAGGCCAGGCAGT - UNI31775 - - UNI35927 - TGCTCCATGGGCCCCTCCTCTGACAAAGCCTTGACCTTCATGAAGGACCATTTTCTG

ATGGATGAGCACGTGGTAGGAACACCCCTGCTGGTGAAGTCTGGTGTGGAGTACACACGGCTTGCTGTGGAGTCAGCTCGGGGCCTTGATGGGAGCAGCC

ATGTGGTCATGTATCTGGGTACCT - UNI23767 - - UNI31775 - CCACGGGGTCCCTGCACAAGGCTGTGGTGCCTCAGGACAGCAGTGCTTA

TCTCGTGGAGGAGATTCAGCTGAGCCCTGACTCTGAGCCTGTTCGAAACCTGCAGCTGGCCCCCGCCCAG - UNI19362 - GGTGCAGTGTTTGCAG

GCTTCTCTGGAGGCATCTGGAGAGTTCCCAGGGCCAATTGCAGTGTCTACGAGAGCTGTGTGGACTGTGTGCTTGCCAGGGACCCTCACTGTGCCTGGGA

CCCTGAATCAAGACTCTGCAGCCTTCTGTCTGGCTCTACCAA - UNI33995 - GCCTTGGAAGCAGGACATGGAACGCGGCAACCCGGAGTGGGTAT

GCACCCGTGGCCCCATGGCCAGGAGCCCCCGGCGTCAGAGCCCCCCTCAACTAA - UNI33995 - TTAAAGAAGTCCTGACAGTCCCCAACTCCATC

CTGGAGCTGCCCTGCCCCCACCTGTCAGCACTGGCCTCTTACCACTGGAGTCATGGCCGAGCCAAAATCTCAGAAGCCTCTGCTACCGTCTACAATGGCT

CCCTCTTGCTGCTGCCGCAGGATGGTGTCGGGGGCCTCTACCAGTGTGTGGCGACTGAGAACGGCTACTCATACCCTGTGGTCTCCTATTGGGTAGACAG

CCAGGACCAGCCCCTGGCGCTGGACCCTGAGCTGGCGGGCGTTCCCCGTGAGCGTGTGCAGGTCCCGCTGACCAGGGTCGGAGGCGGAGCTTCCATGGCT

GCCCAGCGGTCCTACTGGCCCCATTTTCTCATCGTTACCGTCCTCCTGGCCATCGTGCTCCTGGGAGTGCTCACTCTCCTCCTCGCTTCCCCACTGGGGG

CGCTGCGGGCTCGGGGTAAGGTTCAGGGCTGTGGGATGCTGCCCCCCAGGGAAAAGGCTCCACTGAGCAGGGACCAGCACCTCCAGCCCTCCAAGGACCA

CAGGACCTCTGCCAGTGACGTAGATGCCGACAACAACCATCTGGGCGCCGAAGTGGCTTAAACAGGGACACAGATCCGCAGCTGAGCAGAGCAAGCCACT

GGCCTTGTTGGCTATGCCAGGCACAGTGCCACTCTGACCAGGGTAGGAGGCTCTCCTGCTAACGTGTGTCACCTACAGCACCCAGTAGGTCCTCCCCTGT

GGGACTCTCTTCTGCAAGCACATTGGGCTGTCTCCATACCTGTACTTGTGCTGTGACAGGAAGAGCCAGACAGGTTTCTTTGATTTTGATTGACCCAAGA

GCCCTCCTGTAACAAACGTGCTCCAGGAGACCATGAAAGGTGTGGCTGTCTGGGATTCTGTGGTGACAAACCTAAGCATCCGAGCAAGCTGGGGCTATTC

CTGCAAACTCCATCCTGAACGCTGTCACTCTAGAAGCAGCTGCTGCTTTGAACACCAGCCCACCCTCCTTCCCAAGAGTCTCTATGGAGTTGGCCCCTTG

TGTTTCCTTTACCAGTCATGCCATACTGTTTGGGAAGTCATCTCTGAAGTCTAACCACCTTCCTTCTTGCTTCAGTTTGGACAGATTGTTATTATTGTCT

CTGCCCTGGCTAGAATGGGGGGCATAATCTGAGCCTTGTTCCCTTGTCCAGTGTGGCTGACCCTTGACCTCTTCCTTCCTCCTCCCTTTGTTTTGGGATT

CAGAAAACTGCTTGTCACAGACAATTTATTTTTTATTAAAAAAGATATAAGCTTT
Translation
 MALPSLGQDSWSLLRVFFFQLFLLPSLPPASGTGGQGPMPRVKYHAG GDGHRALSFFQQKGLRDFDTLLLSDDGNTLYVGAREAVLALNIQNPGIPRL

KNM IPWPASERKKTECAFKKKSNE TQCFNFIRVLVSYNATHLYACGTFAFSPACTFI ELQDSLLLPILIDKVMDGKGQSPFDPVHKHTAVLVD DGM

LYSGTMNNFLGSEPILMRTLGSQPVLKTDIFLRWLHA ADASFVAAIPSTQVVYFFFEETASEFDFFEELYISRVAQVCK - UNI35927 - NDVGGE

KLLQKKWTTFLKAQLLCAQPGQLPFNIIRHAVLLPADSPSVSRIYAVFTSQW - UNI31775 - - UNI35927 - WQVGGTRSSAVCAFSLTDIER

VFKGKYKELNKETSRWTTYRGSEVSPRPGS - UNI31775 - - UNI35927 - CSMGPSSDKALTFMKDHFLMDEHVVGTPLLVKSGVEYTRLAVE

SARGLDGSSHVVMYLGTS - UNI23767 - - UNI31775 - STGSLHKAVVPQDSSAYLVEEIQLSPDSEPVRNLQLAPAQ - UNI19362 - G

AVFAGFSGGIWRVPRANCSVYESCVDCVLARDPHCAWDPESRLCSLLSGSTK - UNI33995 - KPWKQDMERGNPEWVCTRGPMARSPRRQSPPQLI

 - UNI33995 - IKEVLTVPNSILELPCPHLSALASYHWSHGRAKISEASATVYNGSLLLLPQDGVGGLYQCVATENGYSYPVVSYWVDSQDQPLALD

PELAGVPRERVQVPLTRVGGGASMAAQRSYWPHFLIVTVLLAIVLLGVLTLLLASPLGALRARGKVQGCGMLPPREKAPLSRDQHLQPSKDHRTSASDVD

ADNNHLGAEVA
Transcript ENSMUST00000107532
Sequence
AGGATCTGTCACAACTCGAGGTAGAAATTCTGGTTTCCCTGGCCTGAAACCCACACTGGCTCTGGCAGGATGGGTGCCTGGAGGGCCGCGCGCCCGTTCC

AGCCAGGCTGAGCCTGCTTGCCTTGCCTGGACCCCCTTCTTTGCCTCGGATGGCACCCTGATTCAGGGTTTGAACACAGGACTTCTCAGTGTGGCTGGCT

CAAGG AACCATCTGGTGACCATCTCAGGCTGACCATGGCCCTACCATCCCTGGGCCAGGACTCATGGAGTCTCCTGCGTGTTTTTTTCTTCCAACTCTT

CCTGCTGCCATCACTGCCACCTGCTTCTGGGACTGGTGGTCAGGGGCCCATGCCCAGAGTCAAATACCATGCTG GAGACGGGCACAGGGCCCTCAGCTT

CTTCCAACAAAAAGGCCTCCGAGACTTTGACACGCTGCTCCTGAGTGACGATGGCAACACTCTCTATGTGGGGGCTCGAGAGGCCGTCCTGGCCTTGAAT

ATCCAGAACCCAGGAATCCCAAGGCTAAAGAACATG ATACCCTGGCCAGCCAGTGAGAGAAAAAAGACCGAATGTGCCTTTAAGAAGAAGAGCAATGAG

 ACACAGTGTTTCAACTTCATTCGAGTCCTGGTCTCTTACAATGCTACTCACCTCTATGCCTGTGGGACCTTTGCCTTCAGCCCTGCCTGTACCTTCATT

 GAACTCCAAGATTCCCTCCTGTTGCCCATCTTGATAGACAAGGTCATGGACGGGAAGGGCCAAAGC CCTTTGACCCTGTTCACAAGCACACAG TCCC

TGGTCTTAGATGGGATGCTTTATTCCGGCACCATGAACAACTTCCTGGGCAGCGAGCCCATCCTGATGCGGACACTGGGATCCCAGCCTGTTCTCAAGAC

TGACATCTTCTTACGCTGGCTGCACG CGGATGCCTCCTTCGTGGCAGCCATTCCATCCACCCAGGTCGTCTATTTCTTCTTTGAGGAGACAGCCAGCGA

GTTTGACTTCTTTGAAGAGCTGTATATATCCAGGGTGGCTCAAGTCTGCAAG - UNI35927 - AACGACGTGGGCGGTGAAAAGCTGCTGCAGAAGA

AGTGGACCACCTTCCTCAAAGCCCAGTTGCTCTGCGCTCAGCCAGGGCAGCTGCCATTCAACATCATCCGCCACGCGGTCCTGCTGCCCGCCGATTCTCC

CTCTGTTTCCCGCATCTACGCAGTCTTTACCTCCCAGTG - UNI31775 - - UNI35927 - GCAGGTTGGCGGGACCAGGAGCTCAGCAGTCTGT

GCCTTCTCTCTCACGGACATTGAGCGAGTCTTTAAAGGGAAGTACAAGGAGCTGAACAAGGAGACCTCCCGCTGGACCACTTACCGGGGCTCAGAGGTCA

GCCCGAGGCCAGGCAGT - UNI31775 - - UNI35927 - TGCTCCATGGGCCCCTCCTCTGACAAAGCCTTGACCTTCATGAAGGACCATTTTCT

GATGGATGAGCACGTGGTAGGAACACCCCTGCTGGTGAAGTCTGGTGTGGAGTACACACGGCTTGCTGTGGAGTCAGCTCGGGGCCTTGATGGGAGCAGC

CATGTGGTCATGTATCTGGGTACCT - UNI23767 - - UNI31775 - CCACGGGGTCCCTGCACAAGGCTGTGGTGCCTCAGGACAGCAGTGCTT

ATCTCGTGGAGGAGATTCAGCTGAGCCCTGACTCTGAGCCTGTTCGAAACCTGCAGCTGGCCCCCGCCCAG - UNI19362 - GGTGCAGTGTTTGCA

GGCTTCTCTGGAGGCATCTGGAGAGTTCCCAGGGCCAATTGCAGTGTCTACGAGAGCTGTGTGGACTGTGTGCTTGCCAGGGACCCTCACTGTGCCTGGG

ACCCTGAATCAAGACTCTGCAGCCTTCTGTCTGGCTCTACCAA - UNI33995 - GCCTTGGAAGCAGGACATGGAACGCGGCAACCCGGAGTGGGTA

TGCACCCGTGGCCCCATGGCCAGGAGCCCCCGGCGTCAGAGCCCCCCTCAACTAA - UNI33995 - TTAAAGAAGTCCTGACAGTCCCCAACTCCAT

CCTGGAGCTGCCCTGCCCCCACCTGTCAGCACTGGCCTCTTACCACTGGAGTCATGGCCGAGCCAAAATCTCAGAAGCCTCTGCTACCGTCTACAATGGC

TCCCTCTTGCTGCTGCCGCAGGATGGTGTCGGGGGCCTCTACCAGTGTGTGGCGACTGAGAACGGCTACTCATACCCTGTGGTCTCCTATTGGGTAGACA

GCCAGGACCAGCCCCTGGCGCTGGACCCTGAGCTGGCGGGCGTTCCCCGTGAGCGTGTGCAGGTCCCGCTGACCAGGGTCGGAGGCGGAGCTTCCATGGC

TGCCCAGCGGTCCTACTGGCCCCATTTTCTCATCGTTACCGTCCTCCTGGCCATCGTGCTCCTGGGAGTGCTCACTCTCCTCCTCGCTTCCCCACTGGGG

GCGCTGCGGGCTCGGGGTAAGGTTCAGGGCTGTGGGATGCTGCCCCCCAGGGAAAAGGCTCCACTGAGCAGGGACCAGCACCTCCAGCCCTCCAAGGACC

ACAGGACCTCTGCCAGTGACGTAGATGCCGACAACAACCATCTGGGCGCCGAAGTGGCTTAAACAGGGACACAGATCCGCAGCTGAGCAGAGCAAGCCAC

TGGCCTTGTTGGCTATGCCAGGCACAGTGCCACTCTGACCAGGGTAGGAGGCTCTCCTGCTAACGTGTGTCACCTACAGCACCCAGTAGGTCCTCCCCTG

TGGGACTCTCTTCTGCAAGCACATTGGGCTGTCTCCATACCTGTACTTGTGCTGTGACAGGAAGAGCCAGACAGGTTTCTTTGATTTTGATTGACCCAAG

AGCCCTCCTGTAACAAACGTGCTCCAGGAGACCATGAAAGGTGTGGCTGTCTGGGATTCTGTGGTGACAAACCTAAGCATCCGAGCAAGCTGGGGCTATT

CCTGCAAACTCCATCCTGAACGCTGTCACTCTAGAAGCAGCTGCTGCTTTGAACACCAGCCCACCCTCCTTCCCAAGAGTCTCTATGGAGTTGGCCCCTT

GTGTTTCCTTTACCAGTCATGCCATACTGTTTGGGAAGTCATCTCTGAAGTCTAACCACCTTCCTTCTTGCTTCAGTTTGGACAGATTGTTATTATTGTC

TCTGCCCTGGCTAGAATGGGGGGCATAATCTGAGCCTTGTTCCCTTGTCCAGTGTGGCTGACCCTTGACCTCTTCCTTCCTCCTCCCTTTGTTTTGGGAT

TCAGAAAACTGCTTGTCACAGACAATTTATTTTTTATTAAAAAAGATATAAGCTTT
Translation
 MALPSLGQDSWSLLRVFFFQLFLLPSLPPASGTGGQGPMPRVKYHAG GDGHRALSFFQQKGLRDFDTLLLSDDGNTLYVGAREAVLALNIQNPGIPRL

KNM IPWPASERKKTECAFKKKSNE TQCFNFIRVLVSYNATHLYACGTFAFSPACTFI ELQDSLLLPILIDKVMDGKGQS PLTLFTSTQ SLVLDGM

LYSGTMNNFLGSEPILMRTLGSQPVLKTDIFLRWLHA ADASFVAAIPSTQVVYFFFEETASEFDFFEELYISRVAQVCK - UNI35927 - NDVGGE

KLLQKKWTTFLKAQLLCAQPGQLPFNIIRHAVLLPADSPSVSRIYAVFTSQW - UNI31775 - - UNI35927 - WQVGGTRSSAVCAFSLTDIER

VFKGKYKELNKETSRWTTYRGSEVSPRPGS - UNI31775 - - UNI35927 - CSMGPSSDKALTFMKDHFLMDEHVVGTPLLVKSGVEYTRLAVE

SARGLDGSSHVVMYLGTS - UNI23767 - - UNI31775 - STGSLHKAVVPQDSSAYLVEEIQLSPDSEPVRNLQLAPAQ - UNI19362 - G

AVFAGFSGGIWRVPRANCSVYESCVDCVLARDPHCAWDPESRLCSLLSGSTK - UNI33995 - KPWKQDMERGNPEWVCTRGPMARSPRRQSPPQLI

 - UNI33995 - IKEVLTVPNSILELPCPHLSALASYHWSHGRAKISEASATVYNGSLLLLPQDGVGGLYQCVATENGYSYPVVSYWVDSQDQPLALD

PELAGVPRERVQVPLTRVGGGASMAAQRSYWPHFLIVTVLLAIVLLGVLTLLLASPLGALRARGKVQGCGMLPPREKAPLSRDQHLQPSKDHRTSASDVD

ADNNHLGAEVA

For any suggestions or comments, please send an email to unitrap@crg.es