Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028068 (Iqgap3)
Chromosomal location
Chr 3: 87885973 - 87924970 (+)
Description
IQ motif containing GTPase activating protein 3 Gene [Source:MGI Symbol;Acc:MGI:3028642]
RefSeq_dna
NM_001033484 
RefSeq_peptide
NP_001028656.1 
UniGene
Mm.331133 Mm.418602 
MGI
MGI:3028642 
Uniprot/SPTREMBL
Q3UQP1 
Human Ortholog
ENSG00000183856 (IQGAP3)
Omim not available
UniTrap UNI38000
Vector Insertion
Chr 3: 87887941 - 87890071
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2406
Vector Insertion
Chr 3: 87898670 - 87900823
Public Clones AC0556 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7313
Vector Insertion
Chr 3: 87911643 - 87912282
Public Clones RRT555 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29412
Vector Insertion
Chr 3: 87921707 - 87924084
Public Clones CMHD-GT_519G2-3 (cmhd) CMHD-GT_440E6-3 (cmhd) CMHD-GT_519G2-5S (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000071812
Sequence
GGAACATGGAGCCGTGCGCGGCAGGCCGAGCTCGGACAGCCT ATGAGCGCCTCACAGCTGAGGAAATGGATGAGCAGAGGCGACAGAATGTCGCCTATC

AGTACCTCTGCCGGCTGGAGGAAGCCAAGCG TTGGATGGAGGTGTGCTTGAAGGAGGAGCTTCCTTCCCCTGTGGAGCTGGAGGAGAGCCTCCGGAATG

GAGTGCTACTGGCCAAGCTGGGCCACTGTTTTGCACCCTCTGTGGTCCCCCTGAAGAAGATCTACGACGTGGAGCAGCTACGCTACCAG GCGACTGGCT

TGCATTTCCGGCACACGGACAACATCAACTTTTGGCTCTCTGCGGTAGCCCACATCGGTCTGCCTTCG ATCTTCCTCCCAGAGACCACAGACATCTATG

ACAAAAAGAACATGCCTCGGGTGATCTACTGCATTCACGCTCTCAG TCTCTTCCTCTTCCGGCTGGGATTGGCTCCACAGATCCATGACCTGTATGGGA

AAGTGAAATTCACAG CTGAGGAACTCGGCAACATCGCCTCTGAACTGGCCAAATATGGCCTCCAGTTACCGGCCTTCAGCAAGATCGGGGGCATCCTGG

CCAATGAGTTTTCAGCCGATGAGGCTGCAG TCCATGCAGCTATTCTGGCCATCAATGATGCCGTGGAGCGAGGGGTGGTAGAGGACACTCTGGTCACCT

TGCAGAATCCCAATGCTCTCCTGGGGAATCTTCGAGAACCTCTGGCAGCTGTCTACCAAGAGCTGCTGGCCCTAGCCAAGATGGAGAAGGCGGCCAATGC

CAGGAATCAT GACGATGGTCAGGAGCAGGACATCTATGAATCCTGCCTCACCCAGGCAGAGATCCAGGGCCACATCAACCTCGCCAACG TCCAGGGGG

CACTGGAAGTTGTTGACGACGCTCTGGAGAGGCAGAACCCTGGGGCCTTGCTTGAGGCCCTTCACGATCCTGTCCTGGCCCTACAAGGGGTGAGAGGAAC

CTTTGCTGACTGGTACCTGGAACAGCTGACTTCAGACCGAGAGCAGAAATCACAG GAGCTGGGCCTGGTGAGACTTCTAGAAAAGGAGGAGATCCAGGC

TGGTGTGGCTGTAGCCAATGAGAAGGGGGATGAAGAGCAAACTA TGCTCCAGGCTGTGTGGAGGATCAACAAAGCCATCCGGAGGGGAGTGGCTGCTGA

CACCGTGAAGGAGCTCATGTGCCCTGAAGCCCAGCTGCCCCGAGTCTACCCCTTTGCCTCTGCTTTTTACCAGCAAGAGCTGGCTCTCCTCCAGAAGCAG

CAACAGGGG - UNI2406 - GAGCTGGGCCAGGAGGAGCTCTTTGTGGCTGTGGAGATGCTGTCAGCCGTGGTTCTGATTAACCGTGCTCTGGAAGCT

GGAGATGTCTGTGCCTTTTGGGACAATCTAGTGAATCCCGCAACTGGCCTAGCCCAGGTAGAAGAAGAAAATGCCCAACG TTACTTTGATGCCCTGGTG

AAGGTTCAGCAGTTTCAAGGAACACATAGAGGCATCCTGAGCTGGAATGACCTGCAGGCTGCTGTGAGCCAGGTCAATGAACAGGTCCAGGAAGAAACTG

ATC AGGTCCTCGCCATCAGCCTCATCAATGAGGCTCTGGACCAGGGCTGTCCTGAAAAGACTCTGTCTGCCCTGCTGCTTCCTGCAGCTGGCCTGGAAG

ATGTCAGCCTTCATGTTGCACCTCGGTACCATCTCCTCCTTGTGGCTGCTAAGAGGCAGAAAGCACGG GTGACAGGAGACCCTGGAGCTGTGCTGTGGC

TGGAGGAGATCCGCCAAGGAGTGGCCAGAGCCAACGAGGACACAAGCACGGCTCAGAGAA TAGCCCTTGGTGTGGCTGCTATCAACCAGGCCATCAAGG

AGGGCAAGGCAGCCCAGACAGAGCGTGTGTTGAGGAACCCCAATGTGGCCCTCCGAGGGATAGTTCCTGACTGCGCTAAAAGCTACCAGCAGGCCCTGGA

AGGCGCAGCGGCAAAGAAGCAATGCCCTG GGGACACAGCCTTCTGGGTTCAACATGACATGAAGGATGGCACCGCCTACTACCTTCATCTGCAGACCTT

TCAGGGGACTTGGGAGCATCCTTCCGGCTGCCACCTCAATACCTCCCATCTAACCTGGGAGGAGATTCAG TCAGTCATCACCAAGGTCACTGCTGCCCA

TGACCGCCAACTGCTCTGGAAGGCCAATGTTGGCTTTGTCATCAAGCTCCAGGCCCGCCTTCGTGGCTTCCTTGTTCGCCAGAAGTTTGCTGAGTCTTCC

CACGTCTTCAGGACCTTGCTTCCAGCCGTCATCAAGATCCAG GCTCACTGGCGGGGTTATAGACAACGGAAGGCTTACCAGGAGCGGCTGCAGCATTTT

AAAGCGAACCTGGATGCTATAATCAAG ATCCAGGCCTGGGCCCGAATGTGGGCAGCACGGAGGCGATACCTCAGGCGTCTGCGATACTTCCAGAAGAAC

 GTTGACTCCGTTGTGAAGATTCAAGCATTTTTCCGAGCCAGGAAAGCCCGTGATGACTACAGGATGTTAG TGCACGCACGCCATCCTCCCCTCTGTGT

AGTCCGAAAATTCGCTCACCTCTTGAACCAGAGTCAGGAGGACTTCTCAGCTGAATCGGAGTTGCTAAAGCTCCAAGAGGAAGTGGTTAGGAAGATCCGC

TCTAACCAGCAGCTGGAGCAGGACCTCAACCTCATGGACATCAAGATTGGTCTGCTCGTCAAGAACCGCATCACCCTGCAG - UNI7313 - GAGGTA

GTCTCCCACTGCAAGAAGCTGACCAAGAAGAATAAGGAGCAACTGTCGGACATGATGATCCTGGACAAACAGAAGGGATTAAAGTCACTGAGCAGAGAGA

AACGGCAGAAGCTAGAAGCCTACCAGCACCTCTTCTACCTGCTGCAG ACTCAGCCCATCTATTTGGCCAAGCTGATCTTTCAGATGCCCCAGAACAAAA

CTACCAAGTTCATGGAAGGTGTGATTTTCAGTCTGTACAACTATGCCTCCAACCGTCGGGAGGCCTACCTTCTGCTCCAGCTGTTCAGGACGGCGCTCCA

GGAGGAAATAAA GTCAAAGGTGGAACAGCCCCAGGATGTGGTGACAGGCAACCCCACAGTGGTGAGACTGGTGGTGAGGTTCTACCGCAATGGGCGGGG

ACAGAGCGCTCTGCAGGAGATCCTTGGCAAGGTCATCCAGGATGTGCTAGAAGACAGGTCAGTCAGCATCCACACAGACCCTGTCCACATCTATAAGAGC

TGGATCAACCAGGAGGAGGCCCAGACTGGACAGCGCAG CCATCTCCCCTATGACGTCACCCCTGAGCAGGCTCTGAGCCACTCTGAAGTGCAGAGACGA

TTAGACATCTCCCTGCGCAGTCTCCTCACCTTGACTGAGAAGTTCTTTGTCGCCATCAGTTCATCTGTGGACCACATTCC GTATGGGATGAGGTATATG

GCCAAAGTCCTGAAAACAACCTTGGAGAAGAAGTTCCCCAATGCCACCGAGAGGGACATCTATAAG GTGGTTGGGAACCTCCTGTACTACCGCTTCCTG

AACCCAGCTGTGGTCGCTCCTGATGCCTTTGACATTGTGGCCATGGCGGCAGGCAGCACCCTGGCCGCCCCACAGCGCCATGCGCTGGGAGCCGTGGCTC

AGCTCCTACAGCACGCTGCTGCTGGCCAGATCTTCTCTGGGGAGAGCCGGCACCTTCGAGTCCTGAATGACTACCTGGAGGACTTGCATCTCAAGTTCAG

 GAAGTTCATCTGCAGAGCCTGCCGGGTACCAGAGCCAGAGGAGCGCTTCGCCATCGATGAATACTCAGACATGGTGGCTGTGGCCAAACCCATGGTGTA

CATCACTGTAGGGGAGCTCATCGGCACACACAGG CTCTTGCTCGAACACCAAGACCAGCTGGCCCCAGGTCACCAAGACCCACTGCACCAGCTCCTAGA

AGACCTTGGGGAGCCACCCACCATCTCTGACCTCATTG GGGACAACATAGCCACAGACGGGCATGTGGACCTGAGCAGGCTCGAAGTGTCCCTGACACT

CACCAACAAGTTTGAAGGGCTGGAGACAGATGCTGACCACAACAGCAACCAAAGTCTGCTTCTGAG CACCAAACAGATGCTGGCCGACCTCATCCAGTT

CCACCCTGGGGAGTCCCTGGAAGAGATCCTGACCTCCTCGGCTCCCAGAGAGCAT GAAGAAGCCCATCGTCGGTTGATGTGTTGGCGCCAAGCCTGTGA

CACCCAGAAACCAGAGCCACTTCGACGACACCACTCACTAATGGCACACAGTCTCCTGTCACTGTCGGAGAAGCAGCAACGCGTTCTGCGGAACCTGCGT

CGGCTACAGGGCCTGGGGCTGGTCAGGGCCAGTGACTGCTACCAGGGACTTGTAGACGAGCTGGCCAAG GACATCTGCAACCAGCGTAGGCACCGGCAA

CGGCGGAAGGCAGAGATGCTGAGGCTCCGGACCACACTGCAGGGCCTAGATGCAAAAACCATCTTCTATGAGGAACAGGGTGACTACTACAACCAATACA

TCCAGGCCTGCCTTGACCACCTGGCCCCCAAACCCAA GAGTTCTGGGAAGGGGAAGAAGCAGCCGTCTCTTCACTACACAGCCGCCCAGCTCCTAGAAA

AGGGCGTCTTGGTGGAAATTGAAGATCTCCCTGTTTCTCA CTTCAGAAACGTCATCTTTGACATCACTCCTGGAGACGAGGCAGGAAGGTTTTTCGTCA

ATGCCAAGTTCCTGGGTGTGGACATGGAGAAGTTTCAGCTCCACTACCAG - UNI29412 - GACCTCTTGCAGCTGCAGTATGAGGGTGTGGCTGTC

ATGAAACTCTTTAACAAAGCCAAAGTCAACGTCAATCTCCTCATCTTCCTGCTCAACAAGAAGTTCCTTCGGAAGTGACGGATGCAGGCGGAACTGAGGC

CTCTCAGCTGACTGGCTGCTGCGCTTCTCCATTACCCAGCTCTTTTCTCCGAAGACCAGAGCTCGGGCCACAATGCTTGACCCTCCCGCCCAAGAGGAAT

TGTCCTACTTGGCTGAAGTGGGCCATGCTCCAGGTCCGGCCGGGTGGCTTTTACCACATCCCCGGGAACCAGGAGCCTGCACTCAGTCCTGCAAAGAACC

ATGGTTTTGTGTCGCTACTGCTCTCGTGTGGTCACCACGGTGTCCGCCAGTCGTCCTAGCACTGCCCAGCAGCCTTATCTCCCTTCCTTTCCACGGGCTT

CCAAAGCCCGGGCCAGGCTGTCTGCCCAACTCCGCTTCATAAGCCATGGGTGTCGCTGTCCCCTACAGCCCAGGTCCCTCTGTGCTGTGCCCCTCAGCCA

CCTCTATCATCCTGTCCTAGCCTTGACTTGGTGCAGCACTTGCTGATGTCCATGACAGCTGAGTGCACACCTCAAATCTCCTTTCCCCACTTGTGGTGGT

TCTTATGTGGGTCACTGGGGTATTTATTCTAACCTGATTGTTGTGTGGCCTTAATCATGGTTTTAATTCTCACTTTCTGAACTCAGAGTTCTTGTCTTGC

CATCTTCTCGTCACCTCAGAGCTGACTTCCAGGTGGTTCTCATAGACCTGTAGGCCAGCCTTGGCCATCTCTGTCCTCCCCACATCTCCCATCTTCCTGC

CTCACTGCCCTCTAGATTTCCTCTTAATAAAATGTTATTTCCTATGTTAA
Translation
MEPCAAGRARTAY YERLTAEEMDEQRRQNVAYQYLCRLEEAKR RWMEVCLKEELPSPVELEESLRNGVLLAKLGHCFAPSVVPLKKIYDVEQLRYQ A

TGLHFRHTDNINFWLSAVAHIGLPS IFLPETTDIYDKKNMPRVIYCIHALS SLFLFRLGLAPQIHDLYGKVKFTA AEELGNIASELAKYGLQLPAFS

KIGGILANEFSADEAAV VHAAILAINDAVERGVVEDTLVTLQNPNALLGNLREPLAAVYQELLALAKMEKAANARNH DDGQEQDIYESCLTQAEIQGH

INLANV VQGALEVVDDALERQNPGALLEALHDPVLALQGVRGTFADWYLEQLTSDREQKSQ ELGLVRLLEKEEIQAGVAVANEKGDEEQTM MLQAVW

RINKAIRRGVAADTVKELMCPEAQLPRVYPFASAFYQQELALLQKQQQG - UNI2406 - ELGQEELFVAVEMLSAVVLINRALEAGDVCAFWDNLVN

PATGLAQVEEENAQR RYFDALVKVQQFQGTHRGILSWNDLQAAVSQVNEQVQEETDQ QVLAISLINEALDQGCPEKTLSALLLPAAGLEDVSLHVAPR

YHLLLVAAKRQKAR VTGDPGAVLWLEEIRQGVARANEDTSTAQRI IALGVAAINQAIKEGKAAQTERVLRNPNVALRGIVPDCAKSYQQALEGAAAKK

QCPG GDTAFWVQHDMKDGTAYYLHLQTFQGTWEHPSGCHLNTSHLTWEEIQ SVITKVTAAHDRQLLWKANVGFVIKLQARLRGFLVRQKFAESSHVFR

TLLPAVIKIQ AHWRGYRQRKAYQERLQHFKANLDAIIK IQAWARMWAARRRYLRRLRYFQKN VDSVVKIQAFFRARKARDDYRMLV VHARHPPLCV

VRKFAHLLNQSQEDFSAESELLKLQEEVVRKIRSNQQLEQDLNLMDIKIGLLVKNRITLQ - UNI7313 - EVVSHCKKLTKKNKEQLSDMMILDKQK

GLKSLSREKRQKLEAYQHLFYLLQ TQPIYLAKLIFQMPQNKTTKFMEGVIFSLYNYASNRREAYLLLQLFRTALQEEIK KSKVEQPQDVVTGNPTVVR

LVVRFYRNGRGQSALQEILGKVIQDVLEDRSVSIHTDPVHIYKSWINQEEAQTGQRS SHLPYDVTPEQALSHSEVQRRLDISLRSLLTLTEKFFVAISS

SVDHIP PYGMRYMAKVLKTTLEKKFPNATERDIYK VVGNLLYYRFLNPAVVAPDAFDIVAMAAGSTLAAPQRHALGAVAQLLQHAAAGQIFSGESRHL

RVLNDYLEDLHLKFR RKFICRACRVPEPEERFAIDEYSDMVAVAKPMVYITVGELIGTHR LLLEHQDQLAPGHQDPLHQLLEDLGEPPTISDLIG GD

NIATDGHVDLSRLEVSLTLTNKFEGLETDADHNSNQSLLLS STKQMLADLIQFHPGESLEEILTSSAPREH EEAHRRLMCWRQACDTQKPEPLRRHHS

LMAHSLLSLSEKQQRVLRNLRRLQGLGLVRASDCYQGLVDELAK DICNQRRHRQRRKAEMLRLRTTLQGLDAKTIFYEEQGDYYNQYIQACLDHLAPKP

K KSSGKGKKQPSLHYTAAQLLEKGVLVEIEDLPVSH HFRNVIFDITPGDEAGRFFVNAKFLGVDMEKFQLHYQ - UNI29412 - DLLQLQYEGVA

VMKLFNKAKVNVNLLIFLLNKKFLRK

For any suggestions or comments, please send an email to unitrap@crg.es