Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028076 (Cd1d1)
Chromosomal location
Chr 3: 86799760 - 86803259 (-)
Description
CD1d1 antigen Gene [Source:MGI (curated);Acc:Cd1d1-001]
RefSeq_dna
NM_007639 
RefSeq_peptide
NP_031665.2 
UniGene
Mm.1894 
MGI
MGI:107675 MGI:107674 
Uniprot/SWISSPROT
P11609 
Uniprot/SPTREMBL
Q6PG97 Q7TMK5 
Human Ortholog
ENSG00000158473 (CD1D)
Omim not available
UniTrap UNI29321
Vector Insertion
Chr 3: 86801539 - 86801993
Public Clones PSTVUpb10d11 (vanderbilt) PSTVUpb6g4 (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107620
Sequence
GGGAGCAGAGTAAAGCGCAGAAGTCGGAGCCGAGGGCTGTGTAGAACTCTGGCGCTATGCGGTACCTACCATGGCTGTTGCTGTGGGCATTCCTACAGGT

CTGGGGACAATCTGAAG CCCAGCAAAAGAATTACACCTTCCGCTGCCTGCAGATGTCTTCCTTTGCAAACAGAAGCTGGTCCCGCACAGACAGCGTGGT

CTGGCTGGGGGATCTGCAGACTCACCGTTGGAGTAATGACTCAGCCACCATCAGCTTCACGAAGCCATGGTCCCAGG ATCCCATTGAGATCCAGCTGTC

TGCGGGCTGTGAAATGTACCCTGGGAATGCTTCGGAAAGCTTTTTACACGTAGCATTTCAAGGAAAATATGTCGTGAGATTCTGGGGAACGTCCTGGCAG

ACAGTCCCAGGGGCCCCATCTTGGTTAGACTTGCCCATCAAAGTGCTCAACGCTGATCAAGGGACAAGTGCAACCGTGCAGATGCTCCTGAATGACACCT

GCCCCCTATTTGTCCGTGGTCTCCTAGAGGCAGGGAAGTCAGACCTAGAGAAGCAAG - UNI29321 - AGAAGCCAGTGGCCTGGTTGTCCAGTGTC

CCCAGCTCTGCACATGGCCATAGGCAGCTGGTGTGTCATGTCTCTGGCTTCTACCCAAAACCTGTGTGGGTGATGTGGATGCGGGGTGACCAGGAGCAAC

AGGGTACTCACAGAGGTGATTTCCTGCCAAATGCTGATGAGACATGGTATCTTCAAGCAACCCTGGATGTGGAGGCTGGAGAGGAAGCTGGCCTGGCCTG

CAGGGTGAAGCACAGCAGCCTAGGAGGACAGGATATCATCCTCTACTGGG ATGCCAGGCAAGCACCCGTGGGCCTGATCGTCTTCATAGTACTGATCAT

GCTAGTGGTGGTGGGTGCTGTAGTCTACTATATCTGGAGAAGGAGAAG CGCTTATCAAGACATCCGGTGACTCTTCCTTACACCTGCCTCTCCTGAAAT

TCAGACTTTCCAGGCTCTAGGACTTCAGTCCTGGTCTGCTCAGGATCTGGGGATGAAGGAGAGGAATCCTGAAGAAGTGAAGAGCAGCCAGTACGCTCTT

TTCAA
Translation
MRYLPWLLLWAFLQVWGQSEA AQQKNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQD DPIEIQLSAGCEMYPGNASESFL

HVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQE - UNI29321 - EKPVAWLSSVPSSAH

GHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWD DARQAPVGLIVFIVLIMLVV

VGAVVYYIWRRRS SAYQDIR
Transcript ENSMUST00000063869
Sequence
AAAACCCCAGAGCCTTTGTGTACCAGTCCGGGAGCAGAGTAAAGCGCAGAAGTCGGAGCCGAGGGCTGTGTAGAACTCTGGCGCTATGCGGTACCTACCA

TGGCTGTTGCTGTGGGCATTCCTACAGGTCTGGGGACAATCTGAAG CCCAGCAAAAGAATTACACCTTCCGCTGCCTGCAGATGTCTTCCTTTGCAAAC

AGAAGCTGGTCCCGCACAGACAGCGTGGTCTGGCTGGGGGATCTGCAGACTCACCGTTGGAGTAATGACTCAGCCACCATCAGCTTCACGAAGCCATGGT

CCCAGG - UNI29321 - AGAAGCCAGTGGCCTGGTTGTCCAGTGTCCCCAGCTCTGCACATGGCCATAGGCAGCTGGTGTGTCATGTCTCTGGCTTC

TACCCAAAACCTGTGTGGGTGATGTGGATGCGGGGTGACCAGGAGCAACAGGGTACTCACAGAGGTGATTTCCTGCCAAATGCTGATGAGACATGGTATC

TTCAAGCAACCCTGGATGTGGAGGCTGGAGAGGAAGCTGGCCTGGCCTGCAGGGTGAAGCACAGCAGCCTAGGAGGACAGGATATCATCCTCTACTGGG 

ATGCCAGGCAAGCACCCGTGGGCCTGATCGTCTTCATAGTACTGATCATGCTAGTGGTGGTGGGTGCTGTAGTCTACTATATCTGGAGAAGGAGAAG CG

CTTATCAAGACATCCGGTGACTCTTCCTTACACCTGCCTCTCCTGAAATTCAGACTTTCCAGGCTCTAGGACTTCAGTCCTGGTCTGCTCAGGATCTGGG

GATGAAGGAGAGGAATCCTGAAGAAGTGAAGAGCAGCCAGTACGCTCTTTTCAACATTAATTATAAGAAATTAATTATTTGAGTTGTTTCGTCAGTTTCC

ATAGTTTAGAACAAACACAACTGCAAATGTGCGTACCTGCCAGAAACAAGCTGTTGGCAGTGTTTTATGGGATTTGCACTGAACTAGAAAGCATACTTCC

TGCCCAAACAGACGCTCTGAGGTTAGTTGGCAAGTGTAAAGTCCAACACCAACCTGGCTGTACTCTGTATTTTTCAAGGTGACTAGAAAAATGGATTTGT

GTGTGTGTGACATACAGCTTTGGGGTTTGTTGGCAAGTGTAAAATCCAACACCAACAGTATTTTTCAAGTTAACTAGAAAAATGGCTTGTGTGTGATGCC

GTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCACACACACAGATTTTAAAAAGTGAATGCAAATATCTGCAAATGTTTGCTACCTTAGATACAAA

CCTGCCAATTAATGATAACTCCAAGGGCCTCCAATTTGTGGCTCTTTTAATAATGTTTGTTCTAAATGCCATAATGACCATCTTAGGACACAGTCTCTAT

GGAAATTTTGCATTAATGACTGAAAGGTGTTTTTTCTTTAAAATAAAATAGGATGTAAAATG
Translation
MRYLPWLLLWAFLQVWGQSEA AQQKNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQE - UNI29321 - EKPVAWLSSV

PSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWD DARQAPVGLIVFIVL

IMLVVVGAVVYYIWRRRS SAYQDIR
Transcript ENSMUST00000029717
Sequence
AAAACCCCAGAGCCTTTGTGTACCAGTCCGGGAGCAGAGTAAAGCGCAGAAGTCGGAGCCGAGGGCTGTGTAGAACTCTGGCGCTATGCGGTACCTACCA

TGGCTGTTGCTGTGGGCATTCCTACAGGTCTGGGGACAATCTGAAG CCCAGCAAAAGAATTACACCTTCCGCTGCCTGCAGATGTCTTCCTTTGCAAAC

AGAAGCTGGTCCCGCACAGACAGCGTGGTCTGGCTGGGGGATCTGCAGACTCACCGTTGGAGTAATGACTCAGCCACCATCAGCTTCACGAAGCCATGGT

CCCAGGGCAAGTTGAGTAACCAGCAGTGGGAGAAGTTGCAGCATATGTTTCAAGTCTATCGAGTCAGCTTTACCAGGGACATACAGGAATTAGTCAAAAT

GATGTCACCTAAAGAAGACT ATCCCATTGAGATCCAGCTGTCTGCGGGCTGTGAAATGTACCCTGGGAATGCTTCGGAAAGCTTTTTACACGTAGCATT

TCAAGGAAAATATGTCGTGAGATTCTGGGGAACGTCCTGGCAGACAGTCCCAGGGGCCCCATCTTGGTTAGACTTGCCCATCAAAGTGCTCAACGCTGAT

CAAGGGACAAGTGCAACCGTGCAGATGCTCCTGAATGACACCTGCCCCCTATTTGTCCGTGGTCTCCTAGAGGCAGGGAAGTCAGACCTAGAGAAGCAAG

 - UNI29321 - AGAAGCCAGTGGCCTGGTTGTCCAGTGTCCCCAGCTCTGCACATGGCCATAGGCAGCTGGTGTGTCATGTCTCTGGCTTCTACCCA

AAACCTGTGTGGGTGATGTGGATGCGGGGTGACCAGGAGCAACAGGGTACTCACAGAGGTGATTTCCTGCCAAATGCTGATGAGACATGGTATCTTCAAG

CAACCCTGGATGTGGAGGCTGGAGAGGAAGCTGGCCTGGCCTGCAGGGTGAAGCACAGCAGCCTAGGAGGACAGGATATCATCCTCTACTGGG ATGCCA

GGCAAGCACCCGTGGGCCTGATCGTCTTCATAGTACTGATCATGCTAGTGGTGGTGGGTGCTGTAGTCTACTATATCTGGAGAAGGAGAAG CGCTTATC

AAGACATCCGGTGACTCTTCCTTACACCTGCCTCTCCTGAAATTCAGACTTTCCAGGCTCTAGGACTTCAGTCCTGGTCTGCTCAGGATCTGGGGATGAA

GGAGAGGAATCCTGAAGAAGTGAAGAGCAGCCAGTACGCTCTTTTCAACATTAATTATAAGAAATTAATTATTTGAGTTGTTTCGTCAGTTTCCATAGTT

TAGAACAAACACAACTGCAAATGTGCGTACCTGCCAGAAACAAGCTGTTGGCAGTGTTTTATGGGATTTGCACTGAACTAGAAAGCATACTTCCTGCCCA

AACAGACGCTCTGAGGTTAGTTGGCAAGTGTAAAGTCCAACACCAACCTGGCTGTACTCTGTATTTTTCAAGGTGACTAGAAAAATGGATTTGTGTGTGT

GTGACATACAGCTTTGGGGTTTGTTGGCAAGTGTAAAATCCAACACCAACAGTATTTTTCAAGTTAACTAGAAAAATGGCTTGTGTGTGATGCCGTGTGT

GTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCACACACACAGATTTTAAAAAGTGAATGCAAATATCTGCAAATGTTTGCTACCTTAGATACAAACCTGCC

AATTAATGATAACTCCAAGGGCCTCCAATTTGTGGCTCTTTTAATAATGTTTGTTCTAAATGCCATAATGACCATCTTAGGACACAGTCTCTATGGAAAT

TTTGCATTAATGACTGAAAGGTGTTTTTTCTTTAAAATAAAATAGGATGTAAAATG
Translation
MRYLPWLLLWAFLQVWGQSEA AQQKNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRD

IQELVKMMSPKEDY YPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEA

GKSDLEKQE - UNI29321 - EKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLAC

RVKHSSLGGQDIILYWD DARQAPVGLIVFIVLIMLVVVGAVVYYIWRRRS SAYQDIR

For any suggestions or comments, please send an email to unitrap@crg.es