Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028101 (Pias3)
Chromosomal location
Chr 3: 96500307 - 96509885 (+)
Description
protein inhibitor of activated STAT 3 Gene [Source:MGI Symbol;Acc:MGI:1913126]
RefSeq_dna
NM_018812 NM_146135 
RefSeq_peptide
NP_061282.1 NP_666247.1 
MGI
MGI:1913126 
Uniprot/SWISSPROT
O54714 
Uniprot/SPTREMBL
Q3TM95 Q3UYT2 
Human Ortholog
ENSG00000131788 (PIAS3)
Omim not available
UniTrap UNI35360
Vector Insertion
Chr 3: 96500455 - 96501039
Public Clones IST10065F5 (tigm) IST10065B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32448
Vector Insertion
Chr 3: 96501119 - 96503342
Public Clones (sanger) 5SD086E06 (ggtc) IST14607E7 (tigm) IST14347E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23114
Vector Insertion
Chr 3: 96503342 - 96503761
Public Clones not available
Private Clones OST275922 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26140
Vector Insertion
Chr 3: 96506171 - 96506279
Public Clones not available
Private Clones OST134896 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33248
Vector Insertion
Chr 3: 96508310 - 96508771
Public Clones IST14812C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029743
Sequence
GCCGGTCCCTGGGCCTGAGCTCCGGCTCGGGCTGGGGCGCCTGCGATGTCTCAAGATGGCGGAGCTGGGCGAGTTAAAG - UNI23114 - - UNI32

448 - CACATGGTGATGAGTTTCCGAGTGTCTGAGCTCCAGGTGCTCCTCGGCTTCGCTGGCAGGAACAAGAGTGGGCGGAAACACGAGCTGCTGGCCA

AGGCCCTGCACCTCCTCAAGTCTAGCTGCGCCCCCAGCGTCCAGATGAAGATCAAAGAACTTTATCGCAGGCGCTTTCCCCGGAAGACCCTGGGGCCTTC

TGATCTCTCCTTGCTTTCTTTGCCCCCTGGCACCTCTCCT - UNI23114 - CCTGTGCACCCCGATGTCACCATGAAGCCACTGCCCTTCTATGAAG

TCTATGGGGAGCTCATCCGACCCACCACCCTTG - UNI23114 - CGTCCACCTCCAGCCAGAGGTTCGAGGAAGCCCACTTCACCTTCGCGCTCACT

CCCCAGCAGCTGCAGCAGATTCTCACGTCCAG GGAGGTTCTGCCAGGAGCCAAGTGTGATTACACCATACAAGTGCAGCTCAG ATTCTGTCTCTGTGA

GACCAGCTGCCCTCAGGAGGACTATTTCCCCCCTAACCTCTTTGTTAAGGTTAATGGGAAACTCTGCCCCCTGCCG GGTTACCTCCCTCCAACCAAGAA

TGGAGCTGAGCCCAAGAGGCCCAGCCGTCCGATCAACATCACACCCTTGGCTCGACTCTCAGCCACTGTCCCCAACACCATCGTAGTTAATTGGTCATCT

GAGTTTGGACGG AATTACTCCTTGTCCGTGTACCTGGTGAGGCAATTGACTGCAGGGACCCTTCTACAAAAACTCAGAGCCAAGGGGATCCGGAATCCA

GACCATTCCCGGGCACTGA TCAAGGAGAAACTGACTGCTGACCCCGACAGTGAAGTGGCTACTACAAGTCTCCGGGTGTCACTCATGTGCCCG - UNI

26140 - CTAGGGAAGATGCGCCTGACTGTCCCGTGTCGTGCCCTCACCTGTGCCCATCTGCAGAGTTTCGATGCTGCCCTTTATCTACAGATGAATGA

GAAGAAGCCGACATGGACGTGTCCTGTGTGTGACAAGAAGGCTCCCTATGAGTCGCTGATTATTGATGG TTTATTCATGGAAATTCTTAATTCCTGTTC

GGATTGTGATGAGATCCAGTTCATGGAAGATGGATCCTGGTGTCCGATGAAACCCAAGAAGGAGGCATCAGAGGTTTGCCCCCCGCCAGGGTATGGGCTG

GATG GTCTCCAGTACAGCGCAGTCCAGGAGGGAATTCAGCCAGAGAGTAAGAAGAGGGTCGAAGTCATTGACTTGACCATCGAAAGCTCATCAGATGAG

GAGGATTTGCCCCCCACCAAGAAGCACTGCCCTGTCACCTCAGCGGCCATTCCAGCCCTTCCTGGAAGCAAAGG AGCCCTGACCTCTGGTCACCAGCCA

TCCTCGGTGCTGCGGAGCCCTGCAATGGGCACACTGGGCAGTGACTTCCTGTCTAGTCTCCCGCTACATGAGTACCCACCTGCCTTCCCACTGGGGGCTG

ACATCCAAG GTTTAGATTTATTTTCTTTCCTTCAGACTGAGAGTCAG - UNI33248 - CACTACGGCCCTTCAGTTATCACTTCGCTAGATGAACA

GGACACCCTTGGCCACTTCTTCCAGTACCGGGGAACCCCTTCCCACTTCCTGGGCCCACTGGCCCCCACACTGGGGAGCTCTCACCGCAGCTCCACTCCA

GCGCCCCCTCCTGGTCGTGTCAGCAGCATTGTGGCTCCTGGGAGCTCCTTGAGGGAAGGGCATGGAGGACCCCTGCCTTCAGGTCCCTCTTTGACTGGCT

GTCGGTCAGACGTCATTTCCTTGGACTGAGCTTTTTGGATTATGAAATCAATCTCCATTGGCCCCAGCACTGAGCAGATCACGTTGTGGGTTCCGAACCC

CTGGCTGCTCTGATCCCTCAGGGGTCATTGGCCAAAGGCCAGGCCAGAGCTTCATGGATACCTGCTTTTGGCCTTATCGCTGCCTAACAGGCCAGTACTC

ACAGGGTTAACATTTAACCTTTTTATGGTGGCACATTCCTCTGGGTATGGTAACCTAGGCAGTGGGAGGCAGATGGGATAGGGACTGAGGGATGAGGGGG

TCCTTAGCCTTTACCAGATCTTCAGCCTCTTGGGGAAAGGCACTTTCCTGCCTCCTCTCCCAAGACTCTCCGTTCCCTACCCAAACCCAAATATCTGGTC

TTTGACATCCATTCCGTTCTCTTTGACCATACAGTCGGGCGACAGGTCAGAGATGGACAGAGAACTCTATTTTGGATTGCAGATTTCTTTTTTGTACATA

AATAAGAAAACTCCAAAGCATCCAAAGATGAAATCCCTTGCCTTTCACTCCCCAGTGTGACTCGAGGAGGAAACAAGGCCTTAGTTGTGATTCCCAGGGG

CTGGGGAGCAAGGCGTGGCCTGTCTGCTGCCTGGGTCTCTATTTATATATTTAAGTTCACAATGTTTTTATGCTAAACAGCCAAGGGGCGAAGCGTCTAG

TGGCCTGTGTTCAGGCCTGGATTACTCTTGCACCTTTTGTGGGACATGGGGGCTCTGTGTTCTCCTCCCCAATACTCAGGCCCCTTCCTTCAGGGCCAAG

GCCCTGTGATGTGATTTTACTTTTATTCCCAAAGTTGTAGCAGAGTTCTCGCCTACAATAAAGGTTGTGAATGTTC
Translation
 - UNI23114 - - UNI32448 - MVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDLSLLSLPP

GTSP - UNI23114 - PVHPDVTMKPLPFYEVYGELIRPTTLA - UNI23114 - ASTSSQRFEEAHFTFALTPQQLQQILTSR REVLPGAKCDY

TIQVQLR RFCLCETSCPQEDYFPPNLFVKVNGKLCPLP GYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGR NYSLSVYLVRQLTA

GTLLQKLRAKGIRNPDHSRALI IKEKLTADPDSEVATTSLRVSLMCP - UNI26140 - LGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTC

PVCDKKAPYESLIIDG GLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDG GLQYSAVQEGIQPESKKRVEVIDLTIESSSDEEDLP

PTKKHCPVTSAAIPALPGSKG GALTSGHQPSSVLRSPAMGTLGSDFLSSLPLHEYPPAFPLGADIQG GLDLFSFLQTESQ - UNI33248 - HYGP

SVITSLDEQDTLGHFFQYRGTPSHFLGPLAPTLGSSHRSSTPAPPPGRVSSIVAPGSSLREGHGGPLPSGPSLTGCRSDVISLD
Transcript ENSMUST00000107076
Sequence
AGCAGCAACGCTTGGCCGGGCGGAGCTCAGGCCCGGGCGGTGCTGCGGCTGCAGCGTCCAGCTGCCCGACTGAACTCCAGCCGTGCAGCAGACTGCCGGA

GCTGCGCGAGCCCTTTCTGCACCGGGGCTCACCCCCGCAACTCTGCGG - UNI23114 - - UNI32448 - - UNI35360 - CACATGGTGATG

AGTTTCCGAGTGTCTGAGCTCCAGGTGCTCCTCGGCTTCGCTGGCAGGAACAAGAGTGGGCGGAAACACGAGCTGCTGGCCAAGGCCCTGCACCTCCTCA

AGTCTAGCTGCGCCCCCAGCGTCCAGATGAAGATCAAAGAACTTTATCGCAGGCGCTTTCCCCGGAAGACCCTGGGGCCTTCTGATCTCTCCTTGCTTTC

TTTGCCCCCTGGCACCTCTCCTGTAGGCTCCCCCGGCCCCCTTGCTCCCATCCCTCCCACCCTTCTGACCCCTGGCACCTTGCTAGGCCCTAAGCGTGAG

GTGGACATGCATCCTCCTCTGCCGCAGCCTGTGCACCCCGATGTCACCATGAAGCCACTGCCCTTCTATGAAGTCTATGGGGAGCTCATCCGACCCACCA

CCCTTG - UNI23114 - CGTCCACCTCCAGCCAGAGGTTCGAGGAAGCCCACTTCACCTTCGCGCTCACTCCCCAGCAGCTGCAGCAGATTCTCACG

TCCAG GGAGGTTCTGCCAGGAGCCAAGTGTGATTACACCATACAAGTGCAGCTCAG ATTCTGTCTCTGTGAGACCAGCTGCCCTCAGGAGGACTATTT

CCCCCCTAACCTCTTTGTTAAGGTTAATGGGAAACTCTGCCCCCTGCCG GGTTACCTCCCTCCAACCAAGAATGGAGCTGAGCCCAAGAGGCCCAGCCG

TCCGATCAACATCACACCCTTGGCTCGACTCTCAGCCACTGTCCCCAACACCATCGTAGTTAATTGGTCATCTGAGTTTGGACGG AATTACTCCTTGTC

CGTGTACCTGGTGAGGCAATTGACTGCAGGGACCCTTCTACAAAAACTCAGAGCCAAGGGGATCCGGAATCCAGACCATTCCCGGGCACTGA TCAAGGA

GAAACTGACTGCTGACCCCGACAGTGAAGTGGCTACTACAAGTCTCCGGGTGTCACTCATGTGCCCG - UNI26140 - CTAGGGAAGATGCGCCTGA

CTGTCCCGTGTCGTGCCCTCACCTGTGCCCATCTGCAGAGTTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAGAAGCCGACATGGACGTGTCCTGT

GTGTGACAAGAAGGCTCCCTATGAGTCGCTGATTATTGATGG TTTATTCATGGAAATTCTTAATTCCTGTTCGGATTGTGATGAGATCCAGTTCATGGA

AGATGGATCCTGGTGTCCGATGAAACCCAAGAAGGAGGCATCAGAGGTTTGCCCCCCGCCAGGGTATGGGCTGGATG GTCTCCAGTACAGCGCAGTCCA

GGAGGGAATTCAGCCAGAGAGTAAGAAGAGGGTCGAAGTCATTGACTTGACCATCGAAAGCTCATCAGATGAGGAGGATTTGCCCCCCACCAAGAAGCAC

TGCCCTGTCACCTCAGCGGCCATTCCAGCCCTTCCTGGAAGCAAAGG AGCCCTGACCTCTGGTCACCAGCCATCCTCGGTGCTGCGGAGCCCTGCAATG

GGCACACTGGGCAGTGACTTCCTGTCTAGTCTCCCGCTACATGAGTACCCACCTGCCTTCCCACTGGGGGCTGACATCCAAG GTTTAGATTTATTTTCT

TTCCTTCAGACTGAGAGTCAG - UNI33248 - CACTACGGCCCTTCAGTTATCACTTCGCTAGATGAACAGGACACCCTTGGCCACTTCTTCCAGTA

CCGGGGAACCCCTTCCCACTTCCTGGGCCCACTGGCCCCCACACTGGGGAGCTCTCACCGCAGCTCCACTCCAGCGCCCCCTCCTGGTCGTGTCAGCAGC

ATTGTGGCTCCTGGGAGCTCCTTGAGGGAAGGGCATGGAGGACCCCTGCCTTCAGGTCCCTCTTTGACTGGCTGTCGGTCAGACGTCATTTCCTTGGACT

GAGCTTTTTGGATTATGAAATCAATCTCCATTGGCCCCAGCACTGAGCAGATCACGTTGTGGGTTCCGAACCCCTGGCTGCTCTGATCCCTCAGGGGTCA

TTGGCCAAAGGCCAGGCCAGAGCTTCATGGATACCTGCTTTTGGCCTTATCGCTGCCTAACAGGCCAGTACTCACAGGGTTAACATTTAACCTTTTTATG

GTGGCACATTCCTCTGGGTATGGTAACCTAGGCAGTGGGAGGCAGATGGGATAGGGACTGAGGGATGAGGGGGTCCTTAGCCTTTACCAGATCTTCAGCC

TCTTGGGGAAAGGCACTTTCCTGCCTCCTCTCCCAAGACTCTCCGTTCCCTACCCAAACCCAAATATCTGGTCTTTGACATCCATTCCGTTCTCTTTGAC

CATACAGTCGGGCGACAGGTCAGAGATGGACAGAGAACTCTATTTTGGATTGCAGATTTCTTTTTTGTACATAAATAAGAAAACTCCAAAGCATCCAAAG

ATGAAATCCCTTGCCTTTCACTCCCCAGTGTGACTCGAGGAGGAAACAAGGCCTTAGTTGTGATTCCCAGGGGCTGGGGAGCAAGGCGTGGCCTGTCTGC

TGCCTGGGTCTCTATTTATATATTTAAGTTCACAATGTTTTTATGCTAAACAGCCAAGGGGCGAAGCGTCTAGTGGCCTGTGTTCAGGCCTGGATTACTC

TTGCACCTTTTGTGGGACATGGGGGCTCTGTGTTCTCCTCCCCAATACTCAGGCCCCTTCCTTCAGGGCCAAGGCCCTGTGATGTGATTTTACTTTTATT

CCC
Translation
 - UNI23114 - - UNI32448 - - UNI35360 - MVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKT

LGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLTPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFYEVYGELIRPTTLA - UNI23114 - ASTSSQR

FEEAHFTFALTPQQLQQILTSR REVLPGAKCDYTIQVQLR RFCLCETSCPQEDYFPPNLFVKVNGKLCPLP GYLPPTKNGAEPKRPSRPINITPLAR

LSATVPNTIVVNWSSEFGR NYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALI IKEKLTADPDSEVATTSLRVSLMCP - UNI26140 - LGKM

RLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDG GLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDG GL

QYSAVQEGIQPESKKRVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPGSKG GALTSGHQPSSVLRSPAMGTLGSDFLSSLPLHEYPPAFPLGADI

QG GLDLFSFLQTESQ - UNI33248 - HYGPSVITSLDEQDTLGHFFQYRGTPSHFLGPLAPTLGSSHRSSTPAPPPGRVSSIVAPGSSLREGHGGP

LPSGPSLTGCRSDVISLD
Transcript ENSMUST00000107077
Sequence
GCCGGTCCCTGGGCCTGAGCTCCGGCTCGGGCTGGGGCGCCTGCGATGTCTCAAGATGGCGGAGCTGGGCGAGTTAAAG - UNI23114 - - UNI32

448 - CACATGGTGATGAGTTTCCGAGTGTCTGAGCTCCAGGTGCTCCTCGGCTTCGCTGGCAGGAACAAGAGTGGGCGGAAACACGAGCTGCTGGCCA

AGGCCCTGCACCTCCTCAAGTCTAGCTGCGCCCCCAGCGTCCAGATGAAGATCAAAGAACTTTATCGCAGGCGCTTTCCCCGGAAGACCCTGGGGCCTTC

TGATCTCTCCTTGCTTTCTTTGCCCCCTGGCACCTCTCCT - UNI23114 - CCTGTGCACCCCGATGTCACCATGAAGCCACTGCCCTTCTATGAAG

TCTATGGGGAGCTCATCCGACCCACCACCCTTG - UNI23114 - CGTCCACCTCCAGCCAGAGGTTCGAGGAAGCCCACTTCACCTTCGCGCTCACT

CCCCAGCAGCTGCAGCAGATTCTCACGTCCAG GGAGGTTCTGCCAGGAGCCAAGTGTGATTACACCATACAAGTGCAGCTCAG ATTCTGTCTCTGTGA

GACCAGCTGCCCTCAGGAGGACTATTTCCCCCCTAACCTCTTTGTTAAGGTTAATGGGAAACTCTGCCCCCTGCCG GGTTACCTCCCTCCAACCAAGAA

TGGAGCTGAGCCCAAGAGGCCCAGCCGTCCGATCAACATCACACCCTTGGCTCGACTCTCAGCCACTGTCCCCAACACCATCGTAGTTAATTGGTCATCT

GAGTTTGGACGG AATTACTCCTTGTCCGTGTACCTGGTGAGGCAATTGACTGCAGGGACCCTTCTACAAAAACTCAGAGCCAAGGGGATCCGGAATCCA

GACCATTCCCGGGCACTGA TCAAGGAGAAACTGACTGCTGACCCCGACAGTGAAGTGGCTACTACAAGTCTCCGGGTGTCACTCATGTGCCCG - UNI

26140 - CTAGGGAAGATGCGCCTGACTGTCCCGTGTCGTGCCCTCACCTGTGCCCATCTGCAGAGTTTCGATGCTGCCCTTTATCTACAGATGAATGA

GAAGAAGCCGACATGGACGTGTCCTGTGTGTGACAAGAAGGCTCCCTATGAGTCGCTGATTATTGATGG TTTATTCATGGAAATTCTTAATTCCTGTTC

GGATTGTGATGAGATCCAGTTCATGGAAGATGGATCCTGGTGTCCGATGAAACCCAAGAAGGAGGCATCAGAGGTTTGCCCCCCGCCAGGGTATGGGCTG

GATG GTCTCCAGTACAGCGCAGTCCAGGAGGGAATTCAGCCAGAGAGTAAGAAGAGGGTCGAAGTCATTGACTTGACCATCGAAAGCTCATCAGATGAG

GAGGATTTGCCCCCCACCAAGAAGCACTGCCCTGTCACCTCAGCGGCCATTCCAGCCCTTCCTGGAAGCAAAGG AGCCCTGACCTCTGGTCACCAGCCA

TCCTCGGTGCTGCGGAGCCCTGCAATGGGCACACTGGGCAGTGACTTCCTGTCTAGTCTCCCGCTACATGAGTACCCACCTGCCTTCCCACTGGGGGCTG

ACATCCAAG GTTTAGATTTATTTTCTTTCCTTCAGACTGAGAGTCAG - UNI33248 - CACTACGGCCCTTCAGTTATCACTTCGCTAGATGAACA

GGACACCCTTGGCCACTTCTTCCAGTACCGGGGAACCCCTTCCCACTTCCTGGGCCCACTGGCCCCCACACTGGGGAGCTCTCACCGCAGCTCCACTCCA

GCGCCCCCTCCTGGTCGTGTCAGCAGCATTGTGGCTCCTGGGAGCTCCTTGAGGGAAGGGCATGGAGGACCCCTGCCTTCAGGTCCCTCTTTGACTGGCT

GTCGGTCAGACGTCATTTCCTTGGACTGAGCTTTTTGGATTATGAAATCAATCTCCATTGGCCCCAGCACTGAGCAGATCACGTTGTGGGTTCCGAACCC

CTGGCTGCTCTGATCCCTCAGGGGTCATTGGCCAAAGGCCAGGCCAGAGCTTCATGGATACCTGCTTTTGGCCTTATCGCTGCCTAACAGGCCAGTACTC

ACAGGGTTAACATTTAACCTTTTTATGGTGGCACATTCCTCTGGGTATGGTAACCTAGGCAGTGGGAGGCAGATGGGATAGGGACTGAGGGATGAGGGGG

TCCTTAGCCTTTACCAGATCTTCAGCCTCTTGGGGAAAGGCACTTTCCTGCCTCCTCTCCCAAGACTCTCCGTTCCCTACCCAAACCCAAATATCTGGTC

TTTGACATCCATTCCGTTCTCTTTGACCATACAGTCGGGCGACAGGTCAGAGATGGACAGAGAACTCTATTTTGGATTGCAGATTTCTTTTTTGTACATA

AATAAGAAAACTCCAAAGCATCCAAAGATGAAATCCCTTGCCTTTCACTCCCCAGTGTGACTCGAGGAGGAAACAAGGCCTTAGTTGTGATTCCCAGGGG

CTGGGGAGCAAGGCGTGGCCTGTCTGCTGCCTGGGTCTCTATTTATATATTTAAGTTCACAATGTTTTTATGCTAAACAGCCAAGGGGCGAAGCGTCTAG

TGGCCTGTGTTCAGGCCTGGATTACTCTTGCACCTTTTGTGGGACATGGGGGCTCTGTGTTCTCCTCCCCAATACTCAGGCCCCTTCCTTCAGGGCCAAG

GCCCTGTGATGTGATTTTACTTTTATTCCCAAAGTTGTAGCAGAGTTCTCGCCTACAATAAAGGTTGTGAATGTTC
Translation
MAELGELK - UNI23114 - - UNI32448 - HMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPS

DLSLLSLPPGTSP - UNI23114 - PVHPDVTMKPLPFYEVYGELIRPTTLA - UNI23114 - ASTSSQRFEEAHFTFALTPQQLQQILTSR RE

VLPGAKCDYTIQVQLR RFCLCETSCPQEDYFPPNLFVKVNGKLCPLP GYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGR NYSLS

VYLVRQLTAGTLLQKLRAKGIRNPDHSRALI IKEKLTADPDSEVATTSLRVSLMCP - UNI26140 - LGKMRLTVPCRALTCAHLQSFDAALYLQM

NEKKPTWTCPVCDKKAPYESLIIDG GLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDG GLQYSAVQEGIQPESKKRVEVIDLTIE

SSSDEEDLPPTKKHCPVTSAAIPALPGSKG GALTSGHQPSSVLRSPAMGTLGSDFLSSLPLHEYPPAFPLGADIQG GLDLFSFLQTESQ - UNI332

48 - HYGPSVITSLDEQDTLGHFFQYRGTPSHFLGPLAPTLGSSHRSSTPAPPPGRVSSIVAPGSSLREGHGGPLPSGPSLTGCRSDVISLD
Transcript ENSMUST00000064900
Sequence
GCCGGTCCCTGGGCCTGAGCTCCGGCTCGGGCTGGGGCGCCTGCGATGTCTCAAGATGGCGGAGCTGGGCGAGTTAAAG - UNI23114 - - UNI32

448 - CACATGGTGATGAGTTTCCGAGTGTCTGAGCTCCAGGTGCTCCTCGGCTTCGCTGGCAGGAACAAGAGTGGGCGGAAACACGAGCTGCTGGCCA

AGGCCCTGCACCTCCTCAAGTCTAGCTGCGCCCCCAGCGTCCAGATGAAGATCAAAGAACTTTATCGCAGGCGCTTTCCCCGGAAGACCCTGGGGCCTTC

TGATCTCTCCTTGCTTTCTTTGCCCCCTGGCACCTCTCCTGTAGGCTCCCCCGGCCCCCTTGCTCCCATCCCTCCCACCCTTCTGACCCCTGGCACCTTG

CTAGGCCCTAAGCGTGAGGTGGACATGCATCCTCCTCTGCCGCAGCCTGTGCACCCCGATGTCACCATGAAGCCACTGCCCTTCTATGAAGTCTATGGGG

AGCTCATCCGACCCACCACCCTTG - UNI23114 - CGTCCACCTCCAGCCAGAGGTTCGAGGAAGCCCACTTCACCTTCGCGCTCACTCCCCAGCAG

CTGCAGCAGATTCTCACGTCCAG GGAGGTTCTGCCAGGAGCCAAGTGTGATTACACCATACAAGTGCAGCTCAG ATTCTGTCTCTGTGAGACCAGCTG

CCCTCAGGAGGACTATTTCCCCCCTAACCTCTTTGTTAAGGTTAATGGGAAACTCTGCCCCCTGCCG GGTTACCTCCCTCCAACCAAGAATGGAGCTGA

GCCCAAGAGGCCCAGCCGTCCGATCAACATCACACCCTTGGCTCGACTCTCAGCCACTGTCCCCAACACCATCGTAGTTAATTGGTCATCTGAGTTTGGA

CGG AATTACTCCTTGTCCGTGTACCTGGTGAGGCAATTGACTGCAGGGACCCTTCTACAAAAACTCAGAGCCAAGGGGATCCGGAATCCAGACCATTCC

CGGGCACTGA TCAAGGAGAAACTGACTGCTGACCCCGACAGTGAAGTGGCTACTACAAGTCTCCGGGTGTCACTCATGTGCCCG - UNI26140 - C

TAGGGAAGATGCGCCTGACTGTCCCGTGTCGTGCCCTCACCTGTGCCCATCTGCAGAGTTTCGATGCTGCCCTTTATCTACAGATGAATGAGAAGAAGCC

GACATGGACGTGTCCTGTGTGTGACAAGAAGGCTCCCTATGAGTCGCTGATTATTGATGG TTTATTCATGGAAATTCTTAATTCCTGTTCGGATTGTGA

TGAGATCCAGTTCATGGAAGATGGATCCTGGTGTCCGATGAAACCCAAGAAGGAGGCATCAGAGGTTTGCCCCCCGCCAGGGTATGGGCTGGATG GTCT

CCAGTACAGCGCAGTCCAGGAGGGAATTCAGCCAGAGAGTAAGAAGAGGGTCGAAGTCATTGACTTGACCATCGAAAGCTCATCAGATGAGGAGGATTTG

CCCCCCACCAAGAAGCACTGCCCTGTCACCTCAGCGGCCATTCCAGCCCTTCCTGGAAGCAAAGG AGCCCTGACCTCTGGTCACCAGCCATCCTCGGTG

CTGCGGAGCCCTGCAATGGGCACACTGGGCAGTGACTTCCTGTCTAGTCTCCCGCTACATGAGTACCCACCTGCCTTCCCACTGGGGGCTGACATCCAAG

 GTTTAGATTTATTTTCTTTCCTTCAGACTGAGAGTCAG - UNI33248 - CACTACGGCCCTTCAGTTATCACTTCGCTAGATGAACAGGACACCCT

TGGCCACTTCTTCCAGTACCGGGGAACCCCTTCCCACTTCCTGGGCCCACTGGCCCCCACACTGGGGAGCTCTCACCGCAGCTCCACTCCAGCGCCCCCT

CCTGGTCGTGTCAGCAGCATTGTGGCTCCTGGGAGCTCCTTGAGGGAAGGGCATGGAGGACCCCTGCCTTCAGGTCCCTCTTTGACTGGCTGTCGGTCAG

ACGTCATTTCCTTGGACTGAGCTTTTTGGATTATGAAATCAATCTCCATTGGCCCCAGCACTGAGCAGATCACGTTGTGGGTTCCGAACCCCTGGCTGCT

CTGATCCCTCAGGGGTCATTGGCCAAAGGCCAGGCCAGAGCTTCATGGATACCTGCTTTTGGCCTTATCGCTGCCTAACAGGCCAGTACTCACAGGGTTA

ACATTTAACCTTTTTATGGTGGCACATTCCTCTGGGTATGGTAACCTAGGCAGTGGGAGGCAGATGGGATAGGGACTGAGGGATGAGGGGGTCCTTAGCC

TTTACCAGATCTTCAGCCTCTTGGGGAAAGGCACTTTCCTGCCTCCTCTCCCAAGACTCTCCGTTCCCTACCCAAACCCAAATATCTGGTCTTTGACATC

CATTCCGTTCTCTTTGACCATACAGTCGGGCGACAGGTCAGAGATGGACAGAGAACTCTATTTTGGATTGCAGATTTCTTTTTTGTACATAAATAAGAAA

ACTCCAAAGCATCCAAAGATGAAATCCCTTGCCTTTCACTCCCCAGTGTGACTCGAGGAGGAAACAAGGCCTTAGTTGTGATTCCCAGGGGCTGGGGAGC

AAGGCGTGGCCTGTCTGCTGCCTGGGTCTCTATTTATATATTTAAGTTCACAATGTTTTTATGCTAAACAGCCAAGGGGCGAAGCGTCTAGTGGCCTGTG

TTCAGGCCTGGATTACTCTTGCACCTTTTGTGGGACATGGGGGCTCTGTGTTCTCCTCCCCAATACTCAGGCCCCTTCCTTCAGGGCCAAGGCCCTGTGA

TGTGATTTTACTTTTATTCCCAAAGTTGTAGCAGAGTTCTCGCCTACAATAAAGGTTGTGAATGTTC
Translation
MAELGELK - UNI23114 - - UNI32448 - HMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPS

DLSLLSLPPGTSPVGSPGPLAPIPPTLLTPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFYEVYGELIRPTTLA - UNI23114 - ASTSSQRFEEA

HFTFALTPQQLQQILTSR REVLPGAKCDYTIQVQLR RFCLCETSCPQEDYFPPNLFVKVNGKLCPLP GYLPPTKNGAEPKRPSRPINITPLARLSAT

VPNTIVVNWSSEFGR NYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALI IKEKLTADPDSEVATTSLRVSLMCP - UNI26140 - LGKMRLTV

PCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDG GLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDG GLQYSA

VQEGIQPESKKRVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPGSKG GALTSGHQPSSVLRSPAMGTLGSDFLSSLPLHEYPPAFPLGADIQG G

LDLFSFLQTESQ - UNI33248 - HYGPSVITSLDEQDTLGHFFQYRGTPSHFLGPLAPTLGSSHRSSTPAPPPGRVSSIVAPGSSLREGHGGPLPSG

PSLTGCRSDVISLD

For any suggestions or comments, please send an email to unitrap@crg.es