Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028106 (Rprd2)
Chromosomal location
Chr 3: 95563796 - 95622876 (-)
Description
Regulation of nuclear pre-mRNA domain containing 2 Gene [Source:MGI Symbol;Acc:MGI:1922387]
RefSeq_dna
NM_001081293 
RefSeq_peptide
NP_001074762.1 
UniGene
Mm.196275 Mm.472521 
MGI
MGI:1922387 
Uniprot/SWISSPROT
Q6NXI6 
Uniprot/SPTREMBL
Q9D4Z4 Q3UY82 
Human Ortholog
ENSG00000163125 (RPRD2)
Omim not available
UniTrap UNI9428
Vector Insertion
Chr 3: 95594153 - 95622469
Public Clones XE369 (baygenomics) RRD192 (baygenomics) W044A07 (ggtc) E021D11 (ggtc)
W045D01 (ggtc) W044B05 (ggtc) W045C06 (ggtc) CMHD-GT_534C7-3 (cmhd) (cmhd)
CMHD-GT_404C9-3 (cmhd) FHCRC-GT-S15-1G1 (fhcrc) IST13224D2 (tigm) IST14462B3 (tigm)
IST14979G4 (tigm) IST14972E4 (tigm) IST12911A4 (tigm)
Private Clones OST444492 (lexicon) OST389469 (lexicon) OST378798 (lexicon) OST360215 (lexicon)
OST309108 (lexicon) OST267970 (lexicon) OST230965 (lexicon) OST192529 (lexicon)
OST174998 (lexicon) OST170995 (lexicon) OST166256 (lexicon) OST138257 (lexicon)
OST96093 (lexicon) OST34489 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22178
Vector Insertion
Chr 3: 95591308 - 95594022
Public Clones not available
Private Clones OST304636 (lexicon) OST258601 (lexicon) OST211817 (lexicon) OST186173 (lexicon)
OST169556 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9214
Vector Insertion
Chr 3: 95590375 - 95591206
Public Clones RRC150 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23520
Vector Insertion
Chr 3: 95590242 - 95590321
Public Clones not available
Private Clones OST255031 (lexicon) OST197866 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37268
Vector Insertion
Chr 3: 95589030 - 95590242
Public Clones CMHD-GT_462G10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29621
Vector Insertion
Chr 3: 95578034 - 95580721
Public Clones E133G03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9314
Vector Insertion
Chr 3: 95576120 - 95578063
Public Clones XH324 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16151
Vector Insertion
Chr 3: 95570344 - 95575918
Public Clones IST11542A11 (tigm)
Private Clones OST466018 (lexicon) OST457888 (lexicon) OST451380 (lexicon) OST422427 (lexicon)
OST380333 (lexicon) OST367034 (lexicon) OST363651 (lexicon) OST360893 (lexicon)
OST323646 (lexicon) OST292605 (lexicon) OST259609 (lexicon) OST214484 (lexicon)
OST211495 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029751
Sequence
CGCAGCGTGTGGGAGCCGCCAGCGCGCCCAGCAGCTAGCCCTCCTGCCGCCAGAGGAGCCTAGCGCGTGCAGCGTCCCCACCCCCTGGCCGCCCTCCCCT

CCTGCTGCTTTCACGCACTCGCACTGATTGTTTTGCCCGCTCCCGCCGCCGCCGCCGCCGCCGCCGCCAGAGGACCAGAGGCGCTTGTGCAAACCGGGGA

AGATGGCGGCCGGCGGCGGCGGAGGCAGCAGTAAGGCCTCCTCCTCGTCGGCCTCGTCCGCAGGGGCCCTGGAGTCTTCGTTGGATCGAAAATTCCAGTC

GGTGACCAACACCATGGAATCCATTCAAGGCTTGTCGTCCTGGTGTATAGAAAACAAGAAACACCACAGTACAATCGTCTACCATTGGATGAAGTGGCTC

CGGAGAT - UNI9428 - CTACATATCCCCATCGTTTGAATCTCTTTTATCTTGCCAATGATGTCATACAGAATTGTAAACGGAAAAATGCAATCATA

TTTCGTGAATCATTTGCTGATGTGCTTCCTGAAGCAGCTGCTCTAGTGAA - UNI22178 - GGATCCATCCGTCTCTAAGTCTATAGAACGAATCTT

TAAAATCTGGGAAGATCGAAATGTGTACCCAGAAGACATGATTGTGGCATTGAGAGAAGCTTTAA - UNI9214 - - UNI23520 - GTACCACTT

TCAAAACTCAGAAGCAGCTGAAAGAAAATCTGAACAAACAACCGAATAAGCAGTGGAAGAAATCACAAA - UNI23520 - CATCCACGAATCCAAAA

GCTGCTCTCAAATCTAAGATTGTTGCTGAGTTTCGA TCTCAGGCCCTCATTGAAGAGTTGCTGATGTACAAACGATCAGAAGATCAGATAGAACTGAAG

GAGAAACAGTTGTCAACTATGAGAGTGGATGTCTGCAGCACAGAAACTCTCAAGTGTTTAAAAG ATAAAACAGGTGGAAAGAAGTTCTCCAAAGAATTT

GAAGAAGCAAGTTCCAAGCTAGAGGAGTTTGTGAATGGATTAGATAAACAGGTGAAAAATGGGCCCTCACTAACAGAAGCATTAGAGAACGCTGGAATTT

TCTATGAAGCACAGTACAAGGAAGTGAAAGTGGTCGCTAAC - UNI29621 - GCTTACAAAACCTTCGCTAACCGAGTAAACAACTTAAAGAAGAAG

TTGGATCAATTGAAGTCAACCCTTCCTGATCCTGAGGAATCACCAGTCCCCTCTCCAAGTATGGATGCTCCTTCCCCAACTGGTTCTGAGTCTCCATTCC

AGGGCATGGGAGGTGAAGAACCCCAGTCACCGGCCATGGAGAGTGACAAGTCTGCCACACCCGAGCCTGTGACTGATAACCGTGATGTGGAAGACATGGA

ACTCTCAGATGTGGAAGATGATGGATCAAAAATCATTG - UNI29621 - TGGAGGACCGGAAAGAAAAGCCTGTGGAGAAACCTGCTGTCTCCACTG

GTGTGCCCACCAAGTCAACAGAAAGTGTCTCGAAAGCCTCACCGTGTGCCCCACCGTCTGTGCCC - UNI29621 - GACGGCAGCTCCACCTCTCCC

GAAGCCTCTGAGCACTGCACTTCTGTCCCCTTCCCCAACTTTGGTTTTGCCAAACCTGGCAAATGTGGATCTGGCAAAGATCAGTTCCATCCTTAG
Translation
MAAGGGGGSSKASSSSASSAGALESSLDRKFQSVTNTMESIQGLSSWCIENKKHHSTIVYHWMKWLRRS - UNI9428 - STYPHRLNLFYLANDVIQ

NCKRKNAIIFRESFADVLPEAAALVK - UNI22178 - KDPSVSKSIERIFKIWEDRNVYPEDMIVALREALS - UNI9214 - - UNI23520 -

 STTFKTQKQLKENLNKQPNKQWKKSQT - UNI23520 - TSTNPKAALKSKIVAEFR SQALIEELLMYKRSEDQIELKEKQLSTMRVDVCSTETLK

CLKD DKTGGKKFSKEFEEASSKLEEFVNGLDKQVKNGPSLTEALENAGIFYEAQYKEVKVVAN - UNI29621 - AYKTFANRVNNLKKKLDQLKST

LPDPEESPVPSPSMDAPSPTGSESPFQGMGGEEPQSPAMESDKSATPEPVTDNRDVEDMELSDVEDDGSKIIV - UNI29621 - VEDRKEKPVEKPA

VSTGVPTKSTESVSKASPCAPPSVP - UNI29621 - DGSSTSPEASEHCTSVPFPNFGFAKPGKCGSGKDQFHP
Transcript ENSMUST00000090791
Sequence
CGCAGCGTGTGGGAGCCGCCAGCGCGCCCAGCAGCTAGCCCTCCTGCCGCCAGAGGAGCCTAGCGCGTGCAGCGTCCCCACCCCCTGGCCGCCCTCCCCT

CCTGCTGCTTTCACGCACTCGCACTGATTGTTTTGCCCGCTCCCGCCGCCGCCGCCGCCGCCGCCGCCAGAGGACCAGAGGCGCTTGTGCAAACCGGGGA

AGATGGCGGCCGGCGGCGGCGGAGGCAGCAGTAAGGCCTCCTCCTCGTCGGCCTCGTCCGCAGGGGCCCTGGAGTCTTCGTTGGATCGAAAATTCCAGTC

GGTGACCAACACCATGGAATCCATTCAAGGCTTGTCGTCCTGGTGTATAGAAAACAAGAAACACCACAGTACAATCGTCTACCATTGGATGAAGTGGCTC

CGGAGAT - UNI9428 - CTACATATCCCCATCGTTTGAATCTCTTTTATCTTGCCAATGATGTCATACAGAATTGTAAACGGAAAAATGCAATCATA

TTTCGTGAATCATTTGCTGATGTGCTTCCTGAAGCAGCTGCTCTAGTGAA - UNI22178 - GGATCCATCCGTCTCTAAGTCTATAGAACGAATCTT

TAAAATCTGGGAAGATCGAAATGTGTACCCAGAAGACATGATTGTGGCATTGAGAGAAGCTTTAA - UNI9214 - TGGACAGAGCAGCTTCCCATAA

TGCCAGACTGCAAAAACTGCAATGTTTTCCAGGTACCACTTTCAAAACTCAGAAGCAGCTGAAAGAAAATCTGAACAAACAACCGAATAAGCAGTGGAAG

AAATCACAAA - UNI23520 - CATCCACGAATCCAAAAGCTGCTCTCAAATCTAAGATTGTTGCTGAGTTTCGA TCTCAGGCCCTCATTGAAGAGT

TGCTGATGTACAAACGATCAGAAGATCAGATAGAACTGAAGGAGAAACAGTTGTCAACTATGAGAGTGGATGTCTGCAGCACAGAAACTCTCAAGTGTTT

AAAAG ATAAAACAGGTGGAAAGAAGTTCTCCAAAGAATTTGAAGAAGCAAGTTCCAAGCTAGAGGAGTTTGTGAATGGATTAGATAAACAGGTGAAAAA

TGGGCCCTCACTAACAGAAGCATTAGAGAACGCTGGAATTTTCTATGAAGCACAGTACAAGGAAGTGAAAGTGGTCGCTAAC - UNI29621 - GCTT

ACAAAACCTTCGCTAACCGAGTAAACAACTTAAAGAAGAAGTTGGATCAATTGAAGTCAACCCTTCCTGATCCTGAGGAATCACCAGTCCCCTCTCCAAG

TATGGATGCTCCTTCCCCAACTGGTTCTGAGTCTCCATTCCAGGGCATGGGAGGTGAAGAACCCCAGTCACCGGCCATGGAGAGTGACAAGTCTGCCACA

CCCGAGCCTGTGACTGATAACCGTGATGTGGAAGACATGGAACTCTCAGATGTGGAAGATGATGGATCAAAAATCATTG - UNI29621 - TGGAGGA

CCGGAAAGAAAAGCCTGTGGAGAAACCTGCTGTCTCCACTGGTGTGCCCACCAAGTCAACAGAAAGTGTCTCGAAAGCCTCACCGTGTGCCCCACCGTCT

GTGCCCACGACGGCAGCTCCACCTCTCCCGAAGCCTCTGAGCACTGCACTTCTGTCCCCTTCCCCAACTTTGGTTTTGCCAAACCTGGCAAATGTGGATC

TGGCAAAGATCAGTTCCATCCTTAGCAGCCTAACATCAGTCATGAAAAATACGG - UNI9314 - - UNI29621 - GGGTCAGTTCTGCATCAAGA

CCTTCTCCAGGAATTCCTACCAGTCCCAGCAACCTCAGCAGTGGCCTGAAAACACCTGCACCTGCCACAACACCATCTCACAACCCTCTGGCAAATATCC

TGTCAAAGGTGGAGATCACCCCAGAGAGCATTCTCTCTGCTCTTTCTAAAACCCAGACACAGTCAGCCCCTGCACTCCAAG - UNI16151 - GCTTG

TCATCATTACTTCAGAGTGTTACTGCGAACCCTGTGCCAGCCAGTGAAGTCACTTCCCAGAGCACCACAGCCTCCCCTGCGAGCACCACAGGCTCTGCCG

TAAAGGGGAGAAATCTACTCTCCAGTACCCAGTCTTTTATTCCCAAAAGCTTCAACTATTCTCCTAGTTCTTCAACTTCTGAAGTCTCTTCCACTTCAGC

AAGCAAGGCGTCAGTTGGGCAGAGCCCGGTGCTCCCAAGCACTACGTTTAAACTACCATCCAGTTCTTTGGGATTTACTGGTACCCACAATCCTAGCCCT

GCTGCCCCACCTACTGAAGTTGCCGTGTGCCAATCCTCAGAGGTCTCCAAGCCAAAGCCAGAATCAGAGTCCACCTCTCCAAGCCTGGAAATGAAGATCC

ACAACTTCTTGAAAGGTAATCCTGGTTTCAGTGGCTTAAACTTAAACATCCCGATCCTAAGCAGCTTGGGATCCAGTGCCCCATCAGAGGGCCATGCCTC

AGACTTCCAGCGTGGTCCTACTAGCACTTCAGTTGACAGCATCGATGGAACTCCTGTTCGGGATGAACGGAGTGGGACACCCACCCAGGATGAGATGATG

GATAAGCCCACATCCAGCAGCGTAGACACTATGTCCCTGCTGTCTAAGATCATCAGCCCTGGTTCCTCAACACCCAGCAGTACAAGGTCGCCACCTCCAG

GAAGAGATGAAAGCTACCCCCAAGAGCTCCCCAATTCTGTGTCTACATATCGACCGTTTGGTCTGGGCAGTGACTCTCCCTACAAGCAGCCTTCTGGTGG

AGTTGAGAGGCCGTCATCACTGATGGACTCTTCACAGGAAAAGCTCTTCCCAGATACTTCCTTCCAGGAAGACGAGGACTACCGAGATTTTGAGTATTCA

GGGCCTCCTCCATCTGCCATGATGAATCTAGAGAAGAAACCAGCCAAATCCATCCTGAAGTCAAGCAAGCTTTCTGATGCCACTGAGTACCAGCCAATCC

TGTCTAGTTACAACCACAGGGCCCAAGAGTTTGGGGTCAAGTCTGCCTTCCCTCCATCTGTAAGGGCCCTCCTGGACTCTAGTGAGAACTGTGACCGTCT

CTCATCTCCCCCTGGGCTATTTGGTGCCTTCAACATAAGAGGGAATGAACCTGGGTCTGAGCGGTCACCATCACCAAGTAAAAATGATGCATTTTTCACC

CCTGACTCCAACCACAGTGGCTTGTCTCAGTCTACTGCTGGGCATCTCACGTTGCCACAGACACAATACCCAGACTCTCCTCACTCAGTCCCACATCGTT

CCATTTTCTCTTCACAGAGTACCCTTGCCGCTCCAGCAGGCCACCCACCCACATCAGGCGTGGAAAAAGTCCTGGCCTCCACGATTTCCACCACATCGAC

GATTGAGTTTAAGAATATGCTTAAAAACGCCTCACGCAAGCCCTCAGATGATAAGCATTTTGGCCAGACACCCAACAAGGGTACTTCAAGTGATGGTGTC

AGTCTCTCAAACCTCACCCAGCCCAGCTTGCCCACCACTGACCAACAACAGGAAGAACACTATCGAATAGAAACTCGTGTTTCCTCCTCCTGTTTAGACT

TGCCTGACAGCACAGAAGAAAAGGGGGCCCCTATAGAAACTCTAGGTTATCATAACGCAGCTAATAGGAGGATGTCAGGGGAGCCGATAAAGACTGTAGA

GTCTATACGAGTTCCTGGGAAGGGAAATAGAGGACATGGGCGCGAGGTTTCAAGAGTGGGTTGGTTTGATCTGAGCACACCAGGCAGCTCTTTTGACAAT

GGTCCCTCAAGTGCCTCTGAGTTGGCATCCCTTGGGGGTGGGGGCAGCGGAGGCCTCACTGGCTTTAAGACAACGCCGTACAAGGAACGGGCACCCCAGT

TTCAGGAGAGTGTCACCAGCTTTCGTTCCAACAGTTTCAACTCAACATTTGAGCATCATCTCCCCCCATCCCCTTTGGAACATGGGGCACCCTTCCAGAG

AGAGCCAGTGGGGCCGTCATCTGCCCCACCTGCCCCTCCTAAGGATCATGGTGGTATCTTCTCTCGAGAGGCACCCACTCATCTGCCCTCTGTGGATCTT

TCGAACCCCTTTACAAAGGAGGCATCTCTGGCCCACGCTGGCCCACCACCTCCTCCAGGAGAGCACAGCGGAGTTCCTTTCCCTCCACCCCCCCCTCCTC

CACCCCCGGGGGAACTTAGCAGTGGAGGGACTGGTGTCCCCTTTGCTACTCCAGCCCCGCCTCCACCCCCTGTTGACCACTCTGGGGTTGTACCTTTCCC

AACTCCACCACTGCCAGAGCATGGAGTAACTGGGGCTGTGTCAGTTTTTCCCAAGGACCATAGTTCCCTCCTTCAAGGGACCATGGCTGAGCATTTTGGG

GTGCTCACAGGACCCAGGGACCTCAATGGCCCTGGTCTTAACCGTTCACGAGAGAGCCTGAGCCTGCCTTCCCATCCTCTGGAGCACCTGGGCCCAGCCC

TTGGAGGAGGTGGGGGAGGCAACACCAGCAGCAGTGGCCTTCCCTTGAGTCCCGCACACAGAGACGCCATCGGCCGGAGTGGTATGATTTTACGGAGTCC

CCGGCCAGACTTTCGGCCTAGGGAAGCTTTTCTCGGCAGAGACCCATTCCACAGTTTAAAGAGACCCAGGCCACCTTTTGTTAGAGGCCCTCCGTTCTTT

GCACCAAAACGCCCATTTTTCCCTCCCAGGTACTGATGGAAATCTGGGGAAGGCATTTTGAACAGTCTATAGAGAGCATTGGAAGTAGCAGTTTGGGTTT

TTGTTTAAATTTGGTTTTCCTTTCTTGTTTTTTTTTTTCCACTTTGTTTTTTTTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTTTTAATGAAGGGCCCT

CCTTCCAAATTCAGAAAGCATACATGGTAACAGTTTGCTATTATCCAGTCCTCTCTCCACACTTAGGGCCTTTCCAATTTGTTTGTATTTTTTCTTTAAA

AAAACAAAACACACAGGCATAAGTAAACATAACCAAAGCCACATTATTTGGCTGGGGGAGTGGGGAGGATAACAGTATTTATCCCATCTATTGAGAGATT

ACTTACATCGAAATAAAACTTCGGTCAGTACAGGTAATAACGTGCAATGTTGGGGTGTTATTTGGGTCTTGGCCTTGCTGATGGTCAGTAGGAGGAGCCC

TGTCTCCTTCCCTCTCCAGCTAAGCAGCTTCTGTAACCAGCTTGGCTCCCTTCTTTGTATTTTCTACTCTGCAGAGGACCGAGAGTGTTTGCAGAGGGGA

AACAATGGGCAGTGTGGGGCCTGTCGACTTTATTTGCTTTACTCTAAAAGCATGTGGAAACAGAATGCTTTCCTCTTTCCTTTTTTAAGCAGCCTCGTCT

GAACTATTACCAGGCAGTGACTCTGAGGCAGTACAAACTTCATTATGTGCAGTAAAAAGTTTTCTCTTGCTAGATGTGGTAGCACACACAAGTCCAGCAC

TGGGAGGCAGGGGCAAGAGAAGGGCACGTTTGAGGCCAGCCCGGGCTATAGAGTAGAACTTTATCTCAGAAAGAAAGGAAAGTTTCTTTGTTGAAAGAAA

AAGCTGAATATAATAATTTCAAGGTTAAAATGGGAAATGATCACAATATGTAAAGCTAGGGACAGACCACTCAGTGACCAACTGTCTTTTGTAAACAAGG

AAAAGGGAAACATTTTGATGGTTCTCCGTATCTATTCTAAGCCCTTGTCTCCTGCTTTCCCTTACTTTTTCTCCCTCAGTTATTCTGACTAAATTGATAA

TGAATGTAGGTAAAATGTTGTCCCTGCCTTCTTAAAAATTTAAGTAGACACTTAACTTTACTATGGTGCCTAACTGGTGGTTTTCAGCAAACATTAACTA

TTAGAGAAAGGAAAATATTGTGTCTTTATAGTTTCTTTCTACCCTCACCCATCACAGTCCTGTATTCATCCTGTTCTTGCTGTTTCAGAGGCGATTGGGT

GGTATCCTTACATGATACTGCGTAGGCGTGTCTTAGAGGCAGGGGGTACTGAGAAAGCAGCGTCCTGAGGAATCCATGTTATCCCTCAGCAAATAGCATC

TTGGTGCTTTCAGTACCCACCTCTCACCCTCACCCTCACCCTCATTTGAGTTGCCTGAGTCATTGCTGTGGAGGGGAGAGCTTTCTTCCCTGCATTAAAA

ACTTTGTTTGTGTTTCTGCATCGAATCCCTAAGGGGAAGACAATCGTGGATCTTGGAATGTTTCTGTCTTTGTATCTGGGAAGCAGACACTGCACACTAG

GTTTTCTGGTAGTGTGTTGCACCGGGGCACACGCTGAGGACCTCCAGCTAGGTGTGCTGCACCAGTGTGTTGAGCTTTTGAAGGAATTCCAGCAAGTTCA

CACAGGACTCTACAGAGGAAAGAAAAGGAGGGCTTTGGATTCCTCAGTGGGGTGGGTAGGGAATGGAGGGAAGGGTGGCCTGTGGTTGAAGACAATCCTT

TTGTCTTGGAGCAAACCACTTTTTTTTTTTCCTGAAGAAAGGCTGTCCAGCAGAGCCCGGGAGCTGTGATCTCTGTGAGGTACAGCAAGAATCCTCAGAA

TTCACATCCGTTTTGAGCCAGTTCTTTCCTCTCAAGCCTTTCTGCCCTATAGGTCTCCTCACAAAAATGCATGATATCATGACCTCGTGTTTTGGGTTGG

GTATAACATAGCAAAGCAAGGGAAATATAGTTATATACTGAGTCTTAAGACATTTGTTTAGTAAAAAAGAAAAAAAGGTATCAAACAGAGAATGGGGGCG

GGGGCGGGGAAATTGTGACTTTCAGAATTGATTTTTTTTTCCCAGAAATTAAGTGGGGGTATTTTTCAGTCTAGAATAAAAGAATGTGAATTCTTTCTAC

CGCTCTTATTTAAACTTAAATATACTGTTTACTTGAAAAGGCTCTCTTGACTATTTGATTTTCTAAGAAAACAGGGAAGTATCAGGAAAGTGGTTTCTGA

AATGTTGAAGCAGGATAACTGTCTTCAAAAGCATAGCGGCCGCCACAAGACAGGAGTGCGTTGTACAGTTCAAGGACGGACTTTTCAGGGCTTGGGGTTT

GTGGGATATTTTTTGTTTTGTTTTGTTTTTGCCACAAGATCTTCAGTGTGTTTGTTTCAGGGTGGAAGTGGGTGTTATATGAAGCTGTCAGATATTTTAA

GGAAATCTTCCTACAACAGTAAATGAAGACATCTGTATATATGTGATATAGTGAAACAAAAGACATTTCTGGTATTCATAAAGATAAAACAAGGATTTTA

TTCTTCCTGTGTCTGTGATTTAAACTCGGTACCATACTCTGGCTTTTGTATTTCACCCTAAGTTTAAAAATAAATAAACAAGATATTTTTTAAAGAATGC

ACAACATAGTGTGTCTTAGCAAGGACATGAGTCATATGAAGCAGAGTGAGTAGTTGTCACTAAGGTCCTTGATGCTCACTGTAAAAACACAAAGAGTTCC

ATGAATACTCTAGTACCACACAGAAGTACCACAGTGGTGCTGTGTCACATAGGACCCTGAAGGATTTTCTGAGAGTTGATTCAGCTTAGATGGGAGCTCC

CTCCCTGCAACTCTCTGCCTTCCTGGTGTCATCAGAACTTGGTTTGACTCCTAGGAAGGTATCATGAGCAGACTAGGACCTTTCTCCTCTCTGAACCCAG

AAACCTTGTTTATGAGAAGTGTGGTACAGCAAGCTGGTCTCCACCATGTGAGTAGGTGCAGGTTTCTTACTGCACAGTATCCACTCAGTCCTAATATTAC

CTGCTGATGGAGTTAGGCCTCAGCTGTTAGTTTTTGAAGCGGCTGTAAATTACTGCTCCTCCCCCACCACCTTCATATTTTTAACTGGTGGGGTTACCTG

TTAAAATTAAAAAAAAAAAATAGATATGTTGGATTGATATTCTCTCACGTGTTGGATTGATATTCTCTCACGTGTTCAGTGTGGAAAACAAGTACATGCT

TTAGAGGCAACAACAGTGAAATCCTTTTGGAATGTGTATTAATATCATTTAATAAAATAACTAGTTCTAAAGGTTTGACATTTTTCTTTGAGATTGGGGC

TTTGACCAAGGGCCCTTGGCTTTTCTGGTAAGTGCAAACAAAAGTGACTTCTCCTCCCAGGAGCCGAAGCTGCAACGCTGCAGTACAGACCTATGGTTAG

AGATGCTAAATTCTCTCCGTTGCAGATGCAGCATGGCTACCCAGGGCCAAAGGTGAAACAGGCTACAGAATGGAGAACGAGAATCTGGGGACAGCCCTGA

AGATGCCACTAGACTGCCTTTCCACCTGAGGGTATGTGGGAAGGACAAATGGTGGTACGTGTGGGCACGCACACCTGAGGCACATGTGCCGCAGACCCCC

ACCCTCACCCCCACCCCGTATGTTTTCTTCATTGCTGCTTGCACTTACCTCTCCCATCGTCTTGGAGAAAAAAAAAAAAACAAACTGCCTCCAATACTTT

GTTTTCCAGCTTAATAAAATATGTTTTTGTTTGTTGCGTGGTT
Translation
MAAGGGGGSSKASSSSASSAGALESSLDRKFQSVTNTMESIQGLSSWCIENKKHHSTIVYHWMKWLRRS - UNI9428 - STYPHRLNLFYLANDVIQ

NCKRKNAIIFRESFADVLPEAAALVK - UNI22178 - KDPSVSKSIERIFKIWEDRNVYPEDMIVALREALM - UNI9214 - MDRAASHNARLQ

KLQCFPGTTFKTQKQLKENLNKQPNKQWKKSQT - UNI23520 - TSTNPKAALKSKIVAEFR SQALIEELLMYKRSEDQIELKEKQLSTMRVDVCS

TETLKCLKD DKTGGKKFSKEFEEASSKLEEFVNGLDKQVKNGPSLTEALENAGIFYEAQYKEVKVVAN - UNI29621 - AYKTFANRVNNLKKKLD

QLKSTLPDPEESPVPSPSMDAPSPTGSESPFQGMGGEEPQSPAMESDKSATPEPVTDNRDVEDMELSDVEDDGSKIIV - UNI29621 - VEDRKEKP

VEKPAVSTGVPTKSTESVSKASPCAPPSVPTTAAPPLPKPLSTALLSPSPTLVLPNLANVDLAKISSILSSLTSVMKNTG - UNI9314 - - UNI29

621 - GVSSASRPSPGIPTSPSNLSSGLKTPAPATTPSHNPLANILSKVEITPESILSALSKTQTQSAPALQG - UNI16151 - GLSSLLQSVTAN

PVPASEVTSQSTTASPASTTGSAVKGRNLLSSTQSFIPKSFNYSPSSSTSEVSSTSASKASVGQSPVLPSTTFKLPSSSLGFTGTHNPSPAAPPTEVAVC

QSSEVSKPKPESESTSPSLEMKIHNFLKGNPGFSGLNLNIPILSSLGSSAPSEGHASDFQRGPTSTSVDSIDGTPVRDERSGTPTQDEMMDKPTSSSVDT

MSLLSKIISPGSSTPSSTRSPPPGRDESYPQELPNSVSTYRPFGLGSDSPYKQPSGGVERPSSLMDSSQEKLFPDTSFQEDEDYRDFEYSGPPPSAMMNL

EKKPAKSILKSSKLSDATEYQPILSSYNHRAQEFGVKSAFPPSVRALLDSSENCDRLSSPPGLFGAFNIRGNEPGSERSPSPSKNDAFFTPDSNHSGLSQ

STAGHLTLPQTQYPDSPHSVPHRSIFSSQSTLAAPAGHPPTSGVEKVLASTISTTSTIEFKNMLKNASRKPSDDKHFGQTPNKGTSSDGVSLSNLTQPSL

PTTDQQQEEHYRIETRVSSSCLDLPDSTEEKGAPIETLGYHNAANRRMSGEPIKTVESIRVPGKGNRGHGREVSRVGWFDLSTPGSSFDNGPSSASELAS

LGGGGSGGLTGFKTTPYKERAPQFQESVTSFRSNSFNSTFEHHLPPSPLEHGAPFQREPVGPSSAPPAPPKDHGGIFSREAPTHLPSVDLSNPFTKEASL

AHAGPPPPPGEHSGVPFPPPPPPPPPGELSSGGTGVPFATPAPPPPPVDHSGVVPFPTPPLPEHGVTGAVSVFPKDHSSLLQGTMAEHFGVLTGPRDLNG

PGLNRSRESLSLPSHPLEHLGPALGGGGGGNTSSSGLPLSPAHRDAIGRSGMILRSPRPDFRPREAFLGRDPFHSLKRPRPPFVRGPPFFAPKRPFFPPR

Y
Transcript ENSMUST00000098855
Sequence
CGCAGCGTGTGGGAGCCGCCAGCGCGCCCAGCAGCTAGCCCTCCTGCCGCCAGAGGAGCCTAGCGCGTGCAGCGTCCCCACCCCCTGGCCGCCCTCCCCT

CCTGCTGCTTTCACGCACTCGCACTGATTGTTTTGCCCGCTCCCGCCGCCGCCGCCGCCGCCGCCGCCAGAGGACCAGAGGCGCTTGTGCAAACCGGGGA

AGATGGCGGCCGGCGGCGGCGGAGGCAGCAGTAAGGCCTCCTCCTCGTCGGCCTCGTCCGCAGGGGCCCTGGAGTCTTCGTTGGATCGAAAATTCCAGTC

GGTGACCAACACCATGGAATCCATTCAAGGCTTGTCGTCCTGGTGTATAGAAAACAAGAAACACCACAGTACAATCGTCTACCATTGGATGAAGTGGCTC

CGGAGAT - UNI9428 - CTACATATCCCCATCGTTTGAATCTCTTTTATCTTGCCAATGATGTCATACAGAATTGTAAACGGAAAAATGCAATCATA

TTTCGTGAATCATTTGCTGATGTGCTTCCTGAAGCAGCTGCTCTAGTGAA - UNI22178 - GGATCCATCCGTCTCTAAGTCTATAGAACGAATCTT

TAAAATCTGGGAAGATCGAAATGTGTACCCAGAAGACATGATTGTGGCATTGAGAGAAGCTTTAA - UNI9214 - - UNI23520 - CATCCACGA

ATCCAAAAGCTGCTCTCAAATCTAAGATTGTTGCTGAGTTTCGA TCTCAGGCCCTCATTGAAGAGTTGCTGATGTACAAACGATCAGAAGATCAGATAG

AACTGAAGGAGAAACAGTTGTCAACTATGAGAGTGGATGTCTGCAGCACAGAAACTCTCAAGTGTTTAAAAG ATAAAACAGGTGGAAAGAAGTTCTCCA

AAGAATTTGAAGAAGCAAGTTCCAAGCTAGAGGAGTTTGTGAATGGATTAGATAAACAGGTGAAAAATGGGCCCTCACTAACAGAAGCATTAGAGAACGC

TGGAATTTTCTATGAAGCACAGTACAAGGAAGTGAAAGTGGTCGCTAAC - UNI29621 - GCTTACAAAACCTTCGCTAACCGAGTAAACAACTTAA

AGAAGAAGTTGGATCAATTGAAGTCAACCCTTCCTGATCCTGAGGAATCACCAGTCCCCTCTCCAAGTATGGATGCTCCTTCCCCAACTGGTTCTGAGTC

TCCATTCCAGGGCATGGGAGGTGAAGAACCCCAGTCACCGGCCATGGAGAGTGACAAGTCTGCCACACCCGAGCCTGTGACTGATAACCGTGATGTGGAA

GACATGGAACTCTCAGATGTGGAAGATGATGGATCAAAAATCATTG - UNI29621 - TGGAGGACCGGAAAGAAAAGCCTGTGGAGAAACCTGCTGT

CTCCACTGGTGTGCCCACCAAGTCAACAGAAAGTGTCTCGAAAGCCTCACCGTGTGCCCCACCGTCTGTGCCCACGACGGCAGCTCCACCTCTCCCGAAG

CCTCTGAGCACTGCACTTCTGTCCCCTTCCCCAACTTTGGTTTTGCCAAACCTGGCAAATGTGGATCTGGCAAAGATCAGTTCCATCCTTAGCAGCCTAA

CATCAGTCATGAAAAATACGG - UNI9314 - - UNI29621 - GGGTCAGTTCTGCATCAAGACCTTCTCCAGGAATTCCTACCAGTCCCAGCAAC

CTCAGCAGTGGCCTGAAAACACCTGCACCTGCCACAACACCATCTCACAACCCTCTGGCAAATATCCTGTCAAAGGTGGAGATCACCCCAGAGAGCATTC

TCTCTGCTCTTTCTAAAACCCAGACACAGTCAGCCCCTGCACTCCAAG - UNI16151 - GCTTGTCATCATTACTTCAGAGTGTTACTGCGAACCCT

GTGCCAGCCAGTGAAGTCACTTCCCAGAGCACCACAGCCTCCCCTGCGAGCACCACAGGCTCTGCCGTAAAGGGGAGAAATCTACTCTCCAGTACCCAGT

CTTTTATTCCCAAAAGCTTCAACTATTCTCCTAGTTCTTCAACTTCTGAAGTCTCTTCCACTTCAGCAAGCAAGGCGTCAGTTGGGCAGAGCCCGGTGCT

CCCAAGCACTACGTTTAAACTACCATCCAGTTCTTTGGGATTTACTGGTACCCACAATCCTAGCCCTGCTGCCCCACCTACTGAAGTTGCCGTGTGCCAA

TCCTCAGAGGTCTCCAAGCCAAAGCCAGAATCAGAGTCCACCTCTCCAAGCCTGGAAATGAAGATCCACAACTTCTTGAAAGGTAATCCTGGTTTCAGTG

GCTTAAACTTAAACATCCCGATCCTAAGCAGCTTGGGATCCAGTGCCCCATCAGAGGGCCATGCCTCAGACTTCCAGCGTGGTCCTACTAGCACTTCAGT

TGACAGCATCGATGGAACTCCTGTTCGGGATGAACGGAGTGGGACACCCACCCAGGATGAGATGATGGATAAGCCCACATCCAGCAGCGTAGACACTATG

TCCCTGCTGTCTAAGATCATCAGCCCTGGTTCCTCAACACCCAGCAGTACAAGGTCGCCACCTCCAGGAAGAGATGAAAGCTACCCCCAAGAGCTCCCCA

ATTCTGTGTCTACATATCGACCGTTTGGTCTGGGCAGTGACTCTCCCTACAAGCAGCCTTCTGGTGGAGTTGAGAGGCCGTCATCACTGATGGACTCTTC

ACAGGAAAAGCTCTTCCCAGATACTTCCTTCCAGGAAGACGAGGACTACCGAGATTTTGAGTATTCAGGGCCTCCTCCATCTGCCATGATGAATCTAGAG

AAGAAACCAGCCAAATCCATCCTGAAGTCAAGCAAGCTTTCTGATGCCACTGAGTACCAGCCAATCCTGTCTAGTTACAACCACAGGGCCCAAGAGTTTG

GGGTCAAGTCTGCCTTCCCTCCATCTGTAAGGGCCCTCCTGGACTCTAGTGAGAACTGTGACCGTCTCTCATCTCCCCCTGGGCTATTTGGTGCCTTCAA

CATAAGAGGGAATGAACCTGGGTCTGAGCGGTCACCATCACCAAGTAAAAATGATGCATTTTTCACCCCTGACTCCAACCACAGTGGCTTGTCTCAGTCT

ACTGCTGGGCATCTCACGTTGCCACAGACACAATACCCAGACTCTCCTCACTCAGTCCCACATCGTTCCATTTTCTCTTCACAGAGTACCCTTGCCGCTC

CAGCAGGCCACCCACCCACATCAGGCGTGGAAAAAGTCCTGGCCTCCACGATTTCCACCACATCGACGATTGAGTTTAAGAATATGCTTAAAAACGCCTC

ACGCAAGCCCTCAGATGATAAGCATTTTGGCCAGACACCCAACAAGGGTACTTCAAGTGATGGTGTCAGTCTCTCAAACCTCACCCAGCCCAGCTTGCCC

ACCACTGACCAACAACAGGAAGAACACTATCGAATAGAAACTCGTGTTTCCTCCTCCTGTTTAGACTTGCCTGACAGCACAGAAGAAAAGGGGGCCCCTA

TAGAAACTCTAGGTTATCATAACGCAGCTAATAGGAGGATGTCAGGGGAGCCGATAAAGACTGTAGAGTCTATACGAGTTCCTGGGAAGGGAAATAGAGG

ACATGGGCGCGAGGTTTCAAGAGTGGGTTGGTTTGATCTGAGCACACCAGGCAGCTCTTTTGACAATGGTCCCTCAAGTGCCTCTGAGTTGGCATCCCTT

GGGGGTGGGGGCAGCGGAGGCCTCACTGGCTTTAAGACAACGCCGTACAAGGAACGGGCACCCCAGTTTCAGGAGAGTGTCACCAGCTTTCGTTCCAACA

GTTTCAACTCAACATTTGAGCATCATCTCCCCCCATCCCCTTTGGAACATGGGGCACCCTTCCAGAGAGAGCCAGTGGGGCCGTCATCTGCCCCACCTGC

CCCTCCTAAGGATCATGGTGGTATCTTCTCTCGAGAGGCACCCACTCATCTGCCCTCTGTGGATCTTTCGAACCCCTTTACAAAGGAGGCATCTCTGGCC

CACGCTGGCCCACCACCTCCTCCAGGAGAGCACAGCGGAGTTCCTTTCCCTCCACCCCCCCCTCCTCCACCCCCGGGGGAACTTAGCAGTGGAGGGACTG

GTGTCCCCTTTGCTACTCCAGCCCCGCCTCCACCCCCTGTTGACCACTCTGGGGTTGTACCTTTCCCAACTCCACCACTGCCAGAGCATGGAGTAACTGG

GGCTGTGTCAGTTTTTCCCAAGGACCATAGTTCCCTCCTTCAAGGGACCATGGCTGAGCATTTTGGGGTGCTCACAGGACCCAGGGACCTCAATGGCCCT

GGTCTTAACCGTTCACGAGAGAGCCTGAGCCTGCCTTCCCATCCTCTGGAGCACCTGGGCCCAGCCCTTGGAGGAGGTGGGGGAGGCAACACCAGCAGCA

GTGGCCTTCCCTTGAGTCCCGCACACAGAGACGCCATCGGCCGGAGTGGTATGATTTTACGGAGTCCCCGGCCAGACTTTCGGCCTAGGGAAGCTTTTCT

CGGCAGAGACCCATTCCACAGTTTAAAGAGACCCAGGCCACCTTTTGTTAGAGGCCCTCCGTTCTTTGCACCAAAACGCCCATTTTTCCCTCCCAGGTAC

TGATGGAAATCTGGGGAAGGCATTTTGAACAGTCTATAGAGAGCATTGGAAGTAGCAGTTTGGGTTTTTGTTTAAATTTGGTTTTCCTTTCTTGTTTTTT

TTTTTCCACTTTGTTTTTTTTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTTTTAATGAAGGGCCCTCCTTCCAAATTCAGAAAGCATACATGGTAACAG

TTTGCTATTATCCAGTCCTCTCTCCACACTTAGGGCCTTTCCAATTTGTTTGTATTTTTTCTTTAAAAAAACAAAACACACAGGCATAAGTAAACATAAC

CAAAGCCACATTATTTGGCTGGGGGAGTGGGGAGGATAACAGTATTTATCCCATCTATTGAGAGATTACTTACATCGAAATAAAACTTCGGTCAGTACAG

GTAATAACGTGCAATGTTGGGGTGTTATTTGGGTCTTGGCCTTGCTGATGGTCAGTAGGAGGAGCCCTGTCTCCTTCCCTCTCCAGCTAAGCAGCTTCTG

TAACCAGCTTGGCTCCCTTCTTTGTATTTTCTACTCTGCAGAGGACCGAGAGTGTTTGCAGAGGGGAAACAATGGGCAGTGTGGGGCCTGTCGACTTTAT

TTGCTTTACTCTAAAAGCATGTGGAAACAGAATGCTTTCCTCTTTCCTTTTTTAAGCAGCCTCGTCTGAACTATTACCAGGCAGTGACTCTGAGGCAGTA

CAAACTTCATTATGTGCAGTAAAAAGTTTTCTCTTGCTAGATGTGGTAGCACACACAAGTCCAGCACTGGGAGGCAGGGGCAAGAGAAGGGCACGTTTGA

GGCCAGCCCGGGCTATAGAGTAGAACTTTATCTCAGAAAGAAAGGAAAGTTTCTTTGTTGAAAGAAAAAGCTGAATATAATAATTTCAAGGTTAAAATGG

GAAATGATCACAATATGTAAAGCTAGGGACAGACCACTCAGTGACCAACTGTCTTTTGTAAACAAGGAAAAGGGAAACATTTTGATGGTTCTCCGTATCT

ATTCTAAGCCCTTGTCTCCTGCTTTCCCTTACTTTTTCTCCCTCAGTTATTCTGACTAAATTGATAATGAATGTAGGTAAAATGTTGTCCCTGCCTTCTT

AAAAATTTAAGTAGACACTTAACTTTACTATGGTGCCTAACTGGTGGTTTTCAGCAAACATTAACTATTAGAGAAAGGAAAATATTGTGTCTTTATAGTT

TCTTTCTACCCTCACCCATCACAGTCCTGTATTCATCCTGTTCTTGCTGTTTCAGAGGCGATTGGGTGGTATCCTTACATGATACTGCGTAGGCGTGTCT

TAGAGGCAGGGGGTACTGAGAAAGCAGCGTCCTGAGGAATCCATGTTATCCCTCAGCAAATAGCATCTTGGTGCTTTCAGTACCCACCTCTCACCCTCAC

CCTCACCCTCATTTGAGTTGCCTGAGTCATTGCTGTGGAGGGGAGAGCTTTCTTCCCTGCATTAAAAACTTTGTTTGTGTTTCTGCATCGAATCCCTAAG

GGGAAGACAATCGTGGATCTTGGAATGTTTCTGTCTTTGTATCTGGGAAGCAGACACTGCACACTAGGTTTTCTGGTAGTGTGTTGCACCGGGGCACACG

CTGAGGACCTCCAGCTAGGTGTGCTGCACCAGTGTGTTGAGCTTTTGAAGGAATTCCAGCAAGTTCACACAGGACTCTACAGAGGAAAGAAAAGGAGGGC

TTTGGATTCCTCAGTGGGGTGGGTAGGGAATGGAGGGAAGGGTGGCCTGTGGTTGAAGACAATCCTTTTGTCTTGGAGCAAACCACTTTTTTTTTTTCCT

GAAGAAAGGCTGTCCAGCAGAGCCCGGGAGCTGTGATCTCTGTGAGGTACAGCAAGAATCCTCAGAATTCACATCCGTTTTGAGCCAGTTCTTTCCTCTC

AAGCCTTTCTGCCCTATAGGTCTCCTCACAAAAATGCATGATATCATGACCTCGTGTTTTGGGTTGGGTATAACATAGCAAAGCAAGGGAAATATAGTTA

TATACTGAGTCTTAAGACATTTGTTTAGTAAAAAAGAAAAAAAGGTATCAAACAGAGAATGGGGGCGGGGGCGGGGAAATTGTGACTTTCAGAATTGATT

TTTTTTTCCCAGAAATTAAGTGGGGGTATTTTTCAGTCTAGAATAAAAGAATGTGAATTCTTTCTACCGCTCTTATTTAAACTTAAATATACTGTTTACT

TGAAAAGGCTCTCTTGACTATTTGATTTTCTAAGAAAACAGGGAAGTATCAGGAAAGTGGTTTCTGAAATGTTGAAGCAGGATAACTGTCTTCAAAAGCA

TAGCGGCCGCCACAAGACAGGAGTGCGTTGTACAGTTCAAGGACGGACTTTTCAGGGCTTGGGGTTTGTGGGATATTTTTTGTTTTGTTTTGTTTTTGCC

ACAAGATCTTCAGTGTGTTTGTTTCAGGGTGGAAGTGGGTGTTATATGAAGCTGTCAGATATTTTAAGGAAATCTTCCTACAACAGTAAATGAAGACATC

TGTATATATGTGATATAGTGAAACAAAAGACATTTCTGGTATTCATAAAGATAAAACAAGGATTTTATTCTTCCTGTGTCTGTGATTTAAACTCGGTACC

ATACTCTGGCTTTTGTATTTCACCCTAAGTTTAAAAATAAATAAACAAGATATTTTTTAAAGAATGCACAACATAGTGTGTCTTAGCAAGGACATGAGTC

ATATGAAGCAGAGTGAGTAGTTGTCACTAAGGTCCTTGATGCTCACTGTAAAAACACAAAGAGTTCCATGAATACTCTAGTACCACACAGAAGTACCACA

GTGGTGCTGTGTCACATAGGACCCTGAAGGATTTTCTGAGAGTTGATTCAGCTTAGATGGGAGCTCCCTCCCTGCAACTCTCTGCCTTCCTGGTGTCATC

AGAACTTGGTTTGACTCCTAGGAAGGTATCATGAGCAGACTAGGACCTTTCTCCTCTCTGAACCCAGAAACCTTGTTTATGAGAAGTGTGGTACAGCAAG

CTGGTCTCCACCATGTGAGTAGGTGCAGGTTTCTTACTGCACAGTATCCACTCAGTCCTAATATTACCTGCTGATGGAGTTAGGCCTCAGCTGTTAGTTT

TTGAAGCGGCTGTAAATTACTGCTCCTCCCCCACCACCTTCATATTTTTAACTGGTGGGGTTACCTGTTAAAATTAAAAAAAAAAAATAGATATGTTGGA

TTGATATTCTCTCACGTGTTGGATTGATATTCTCTCACGTGTTCAGTGTGGAAAACAAGTACATGCTTTAGAGGCAACAACAGTGAAATCCTTTTGGAAT

GTGTATTAATATCATTTAATAAAATAACTAGTTCTAAAGGTTTGACATTTTTCTTTGAGATTGGGGCTTTGACCAAGGGCCCTTGGCTTTTCTGGTAAGT

GCAAACAAAAGTGACTTCTCCTCCCAGGAGCCGAAGCTGCAACGCTGCAGTACAGACCTATGGTTAGAGATGCTAAATTCTCTCCGTTGCAGATGCAGCA

TGGCTACCCAGGGCCAAAGGTGAAACAGGCTACAGAATGGAGAACGAGAATCTGGGGACAGCCCTGAAGATGCCACTAGACTGCCTTTCCACCTGAGGGT

ATGTGGGAAGGACAAATGGTGGTACGTGTGGGCACGCACACCTGAGGCACATGTGCCGCAGACCCCCACCCTCACCCCCACCCCGTATGTTTTCTTCATT

GCTGCTTGCACTTACCTCTCCCATCGTCTTGGAGAAAAAAAAAAAAACAAACTGCCTCCAATACTTTGTTTTCCAGCTTAATAAAATATGTTTTTGTTTG

TTGCGTGGTT
Translation
MAAGGGGGSSKASSSSASSAGALESSLDRKFQSVTNTMESIQGLSSWCIENKKHHSTIVYHWMKWLRRS - UNI9428 - STYPHRLNLFYLANDVIQ

NCKRKNAIIFRESFADVLPEAAALVK - UNI22178 - KDPSVSKSIERIFKIWEDRNVYPEDMIVALREALT - UNI9214 - - UNI23520 -

 TSTNPKAALKSKIVAEFR SQALIEELLMYKRSEDQIELKEKQLSTMRVDVCSTETLKCLKD DKTGGKKFSKEFEEASSKLEEFVNGLDKQVKNGPSL

TEALENAGIFYEAQYKEVKVVAN - UNI29621 - AYKTFANRVNNLKKKLDQLKSTLPDPEESPVPSPSMDAPSPTGSESPFQGMGGEEPQSPAMES

DKSATPEPVTDNRDVEDMELSDVEDDGSKIIV - UNI29621 - VEDRKEKPVEKPAVSTGVPTKSTESVSKASPCAPPSVPTTAAPPLPKPLSTALL

SPSPTLVLPNLANVDLAKISSILSSLTSVMKNTG - UNI9314 - - UNI29621 - GVSSASRPSPGIPTSPSNLSSGLKTPAPATTPSHNPLANI

LSKVEITPESILSALSKTQTQSAPALQG - UNI16151 - GLSSLLQSVTANPVPASEVTSQSTTASPASTTGSAVKGRNLLSSTQSFIPKSFNYSPS

SSTSEVSSTSASKASVGQSPVLPSTTFKLPSSSLGFTGTHNPSPAAPPTEVAVCQSSEVSKPKPESESTSPSLEMKIHNFLKGNPGFSGLNLNIPILSSL

GSSAPSEGHASDFQRGPTSTSVDSIDGTPVRDERSGTPTQDEMMDKPTSSSVDTMSLLSKIISPGSSTPSSTRSPPPGRDESYPQELPNSVSTYRPFGLG

SDSPYKQPSGGVERPSSLMDSSQEKLFPDTSFQEDEDYRDFEYSGPPPSAMMNLEKKPAKSILKSSKLSDATEYQPILSSYNHRAQEFGVKSAFPPSVRA

LLDSSENCDRLSSPPGLFGAFNIRGNEPGSERSPSPSKNDAFFTPDSNHSGLSQSTAGHLTLPQTQYPDSPHSVPHRSIFSSQSTLAAPAGHPPTSGVEK

VLASTISTTSTIEFKNMLKNASRKPSDDKHFGQTPNKGTSSDGVSLSNLTQPSLPTTDQQQEEHYRIETRVSSSCLDLPDSTEEKGAPIETLGYHNAANR

RMSGEPIKTVESIRVPGKGNRGHGREVSRVGWFDLSTPGSSFDNGPSSASELASLGGGGSGGLTGFKTTPYKERAPQFQESVTSFRSNSFNSTFEHHLPP

SPLEHGAPFQREPVGPSSAPPAPPKDHGGIFSREAPTHLPSVDLSNPFTKEASLAHAGPPPPPGEHSGVPFPPPPPPPPPGELSSGGTGVPFATPAPPPP

PVDHSGVVPFPTPPLPEHGVTGAVSVFPKDHSSLLQGTMAEHFGVLTGPRDLNGPGLNRSRESLSLPSHPLEHLGPALGGGGGGNTSSSGLPLSPAHRDA

IGRSGMILRSPRPDFRPREAFLGRDPFHSLKRPRPPFVRGPPFFAPKRPFFPPRY

For any suggestions or comments, please send an email to unitrap@crg.es