Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028115 (Bnipl)
Chromosomal location
Chr 3: 95045211 - 95055115 (-)
Description
BCL2/adenovirus E1B 19kD interacting protein like Gene [Source:MGI (curated);Acc:Bnipl-001]
RefSeq_dna
NM_134253 
RefSeq_peptide
NP_599014.1 
UniGene
Mm.398344 Mm.331209 
MGI
MGI:2384749 
Uniprot/SWISSPROT
Q99JU7 
Uniprot/SPTREMBL
Q3UQG4 
Human Ortholog
ENSG00000163141 (BNIPL)
Omim not available
UniTrap UNI33178
Vector Insertion
Chr 3: 95049571 - 95052723
Public Clones IST10780B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029760
Sequence
CAGCAGCTGACACAGGAAAGTAAAGAGTTTGGGGGCTGGGGCCACAGCCTCCTATCCTCCTCAAGTCCCACAGGACACAGGACGACCTGGGAAGATGGGG

ACCAGGCAAGAAACAGGAAGAGAGACGTTAGAAGGAGG GGCTAAGGAGAAGGCAGGAGCCTCAGAACCAGGAGCAACCATGAAACTTGGAGAGCTGGAG

CTAAGAGAGGAGTGGCAAGATGAAGAGTTTCCTAG ATTGCTTCCTGAGGAACCTGGCTCACCTGGAGACCCTGAAGACCCTCAGAGAGGCTCACAGGCA

G - UNI33178 - GCACCCCCAGCAGTCTGGCCTTGTGTGGCCAGCGCCCTATGCGGAAGCGTCTTTCCGCCCCAGAATGGCAGCTGAGTCTGACTGA

GGGAACAGGAGAAAACGGAGCCTCTCCCACCCGCTCTGCGTCTTCCTCTTCTGCTGGCAGCTTGGACCTGGAGGTGGATGAGTTGGAGACACCATCAGAC

TCTGAGCAGCTGGACAGCGGACATGAGTTTGAATGGGAAG - UNI33178 - ATGACTTGCCCCGGGCAGAGGGCCTGGGGGCCAGTGAGGCAGCAGA

AAGACTGGGCCGGGGATGCGTGTGCGATGTGGCTGGAGAAGACGGTCATCGCTGGAGAGTGTTTCGAACAGGACAACGAGAGCAGCGAGTGGACATGACC

ATCATTGAGCCCTATAAGAAAGTCTTATCTCATGGAG - UNI33178 - GTTACCATGGTGATGGCCTCAATGCTGTCATCCTCTTTGCTTCCTGCTA

TCTACCCCGAAGCAGCATCCCCAACTACACCTACATCATGGAACACTTATTCAG GTATATGGTGGGAACTTTGGAGCTGCTGGTAGCTGAAAACTATCT

GCTTGTTCACTTGAGTGGAGGCACCAGCAGGGCCCAAGTGCCCCCTCTGAGCTGGATCCGGCAGTGTTACCGTACCTTGGACAGGAG GCTTCGGAAAAA

CCTTCGCGCCCTGGTGGTCGTCCACGCTACGTGGTATGTGAAGGCCTTCCTGGCACTGGTTCGGCCCTTCATCAG CTCCAAGTTCACACGAAAGATCCG

CTTTCTGGACAGCCTCGGAGAGCTGGCCCAGCTCATCTCGCTAGAGCAAGTGCACATACCGGAAGTTGTCAGACA GCTGGACCGGGATCTGCATGGCTC

GAAAGGCACCTAACACAAAGCTGGGCAGAGGGCCTAGGATCTGGCAAAGATCATGAGTGGTCTGCATGGGGGAGCTATGTCTCATCTCATCCTGAGGGCC

AGCTCCACCGGATCCTCACTTTTCAGTGCGACGCCCACTTCTGGACACTGCCTTCAAGCTGGGATTTAAGGGTGGGAACCCCAGAACGGGGTGGGGGGTG

GCTTGCATTTCGGCTGTCCAAAAAGAAGGCTGTGTGGCATTGGAAGTGTAAGGCTCTGAGTTTTAATTCTGCTTTAGCTGTAAAATATGTGGGTCTCATT

TTCCTTCTCTGTAATCAAAACTACTGGGATCCTTCCCAGTTTAGTTGTCTTAGCAGTCTTTGAGGGGAGGTGGATGGAAGGCTTAACCAGCAGCCACAGC

CAGCCTGTCTGCCGGGAGCCCAGGAGCCAGCTTGCAAAATCTTGAAAAGCCAACCCCTTCTTAGTAGTCAGCTGCCTGTGATCCTGAGAACTGCTGTCAA

AACCTGTGTTTTCACTCTCAGTAAATTCAGACCTGTGACCTTT
Translation
 MKLGELELREEWQDEEFPR RLLPEEPGSPGDPEDPQRGSQAG - UNI33178 - GTPSSLALCGQRPMRKRLSAPEWQLSLTEGTGENGASPTRSA

SSSSAGSLDLEVDELETPSDSEQLDSGHEFEWED - UNI33178 - DDLPRAEGLGASEAAERLGRGCVCDVAGEDGHRWRVFRTGQREQRVDMTIIE

PYKKVLSHGG - UNI33178 - GYHGDGLNAVILFASCYLPRSSIPNYTYIMEHLFR RYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYR

TLDRR RLRKNLRALVVVHATWYVKAFLALVRPFIS SSKFTRKIRFLDSLGELAQLISLEQVHIPEVVRQ QLDRDLHGSKGT
Transcript ENSMUST00000107195
Sequence
GCAAACCTGCTCCTTGGGAGGGGAGGTGGCAAAACCTGTTTGAAGATGAGGTTACCTCCCTTCCACACCTCCTGCCTCCTTAGAGCAAAAGCAGCAGCTG

ACACAGGAAAGTAAAGAGTTTGGGGGCTGGGGCCACAGCCTCCTATCCTCCTCAAGTCCCACAGGACACAGGACGACCTGGGAAGATGGGGACCAGGCAA

GAAACAGGAAGAGAGACGTTAGAAGGAGG GGCTAAGGAGAAGGCAGGAGCCTCAGAACCAGGAGCAACCATGAAACTTGGAGAGCTGGAGCTAAGAGAG

GAGTGGCAAGATGAAGAGTTTCCTAG ATTGCTTCCTGAGGAACCTGGCTCACCTGGAGACCCTGAAGACCCTCAGAGAGGCTCACAGGCAG - UNI33

178 - GCACCCCCAGCAGTCTGGCCTTGTGTGGCCAGCGCCCTATGCGGAAGCGTCTTTCCGCCCCAGAATGGCAGCTGAGTCTGACTGAGGGAACAGG

AGAAAACGGAGCCTCTCCCACCCGCTCTGCGTCTTCCTCTTCTGCTGGCAGCTTGGACCTGGAGGTGGATGAGTTGGAGACACCATCAGACTCTGAGCAG

CTGGACAGCGGACATGAGTTTGAATGGGAAG - UNI33178 - ATGACTTGCCCCGGGCAGAGGGCCTGGGGGCCAGTGAGGCAGCAGAAAGACTGGG

CCGGGGATGCGTGTGCGATGTGGCTGGAGAAGACGGTCATCGCTGGAGAGTGTTTCGAACAGGACAACGAGAGCAGCGAGTGGACATGACCATCATTGAG

CCCTATAAGAAAGTCTTATCTCATGGAG - UNI33178 - GTTACCATGGTGATGGCCTCAATGCTGTCATCCTCTTTGCTTCCTGCTATCTACCCCG

AAGCAGCATCCCCAACTACACCTACATCATGGAACACTTATTCAG GTATATGGTGGGAACTTTGGAGCTGCTGGTAGCTGAAAACTATCTGCTTGTTCA

CTTGAGTGGAGGCACCAGCAGGGCCCAAGTGCCCCCTCTGAGCTGGATCCGGCAGTGTTACCGTACCTTGGACAGGAG GCTTCGGAAAAACCTTCGCGC

CCTGGTGGTCGTCCACGCTACGTGGTATGTGAAGGCCTTCCTGGCACTGGTTCGGCCCTTCATCAG CTCCAAGTTCACACGAAAGATCCGCTTTCTGGA

CAGCCTCGGAGAGCTGGCCCAGCTCATCTCGCTAGAGCAAGTGCACATACCGGAAGTTGTCAGACA GCTGGACCGGGATCTGCATGGCTCGAAAGGCAC

CTAACACAAAGCTGGGCAGAGGGCCTAGGATCTGGCAAAGATCATGAGTGGTCTGCATGGGGGAGCTATGTCTCATCTCATCCTGAGGGCCAGCTCCACC

GGATCCTCACTTTTCAGTGCGACGCCCACTTCTGGACACTGCCTTCAAGCTGGGATTTAAGGGTGGGAACCCCAGAACGGGGTGGGGGGTGGCTTGCATT

TCGGCTGTCCAAAAAGAAGGCTGTGTGGCATTGGAAGTGTAAGGCTCTGAGTTTTAATTCTGCTTTAGCTGTAAAATATGTGGGTCTCATTTTCCTTCTC

TGTAATCAAAACTACTGGGATCCTTCCCAGTTTAGTTGTCTTAGCAGTCTTTGAGGGGAGGTGGATGGAAGGCTTAACCAGCAGCCACAGCCAGCCTGTC

TGCCGGGAGCCCAGGAGCCAGCTTGCAAAATCTTGAAAAGCCAACCCCTTCTTAGTAGTCAGCTGCCTGTGATCCTGAGAACTGCTGTCAAAACCTGTGT

TTTCACTCTCAGTAAATTCAGACCTGTGACCTTTAATAAA
Translation
MGTRQETGRETLEGG GAKEKAGASEPGATMKLGELELREEWQDEEFPR RLLPEEPGSPGDPEDPQRGSQAG - UNI33178 - GTPSSLALCGQRP

MRKRLSAPEWQLSLTEGTGENGASPTRSASSSSAGSLDLEVDELETPSDSEQLDSGHEFEWED - UNI33178 - DDLPRAEGLGASEAAERLGRGCV

CDVAGEDGHRWRVFRTGQREQRVDMTIIEPYKKVLSHGG - UNI33178 - GYHGDGLNAVILFASCYLPRSSIPNYTYIMEHLFR RYMVGTLELLV

AENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRR RLRKNLRALVVVHATWYVKAFLALVRPFIS SSKFTRKIRFLDSLGELAQLISLEQVHIPEVVRQ

 QLDRDLHGSKGT
Transcript ENSMUST00000098871
Sequence
CAGCAGCTGACACAGGAAAGTAAAGAGTTTGGGGGCTGGGGCCACAGCCTCCTATCCTCCTCAAGTCCCACAGGACACAGGACGACCTGGGAAGATGGGG

ACCAGGCAAGAAACAGGAAGAGAGACGTTAGAAGGAGG ATTGCTTCCTGAGGAACCTGGCTCACCTGGAGACCCTGAAGACCCTCAGAGAGGCTCACAG

GCAG - UNI33178 - GCACCCCCAGCAGTCTGGCCTTGTGTGGCCAGCGCCCTATGCGGAAGCGTCTTTCCGCCCCAGAATGGCAGCTGAGTCTGAC

TGAGGGAACAGGAGAAAACGGAGCCTCTCCCACCCGCTCTGCGTCTTCCTCTTCTGCTGGCAGCTTGGACCTGGAGGTGGATGAGTTGGAGACACCATCA

GACTCTGAGCAGCTGGACAGCGGACATGAGTTTGAATGGGAAG - UNI33178 - ATGACTTGCCCCGGGCAGAGGGCCTGGGGGCCAGTGAGGCAGC

AGAAAGACTGGGCCGGGGATGCGTGTGCGATGTGGCTGGAGAAGACGGTCATCGCTGGAGAGTGTTTCGAACAGGACAACGAGAGCAGCGAGTGGACATG

ACCATCATTGAGCCCTATAAGAAAGTCTTATCTCATGGAG - UNI33178 - GTTACCATGGTGATGGCCTCAATGCTGTCATCCTCTTTGCTTCCTG

CTATCTACCCCGAAGCAGCATCCCCAACTACACCTACATCATGGAACACTTATTCAG GCTTCGGAAAAACCTTCGCGCCCTGGTGGTCGTCCACGCTAC

GTGGTATGTGAAGGCCTTCCTGGCACTGGTTCGGCCCTTCATCAG CTCCAAGTTCACACGAAAGATCCGCTTTCTGGACAGCCTCGGAGAGCTGGCCCA

GCTCATCTCGCTAGAGCAAGTGCACATACCGGAAGTTGTCAGACA GCTGGACCGGGATCTGCATGGCTCGAAAGGCACCTAACACAAAGCTGGGCAGAG

GGCCTAGGATCTGGCAAAGATCATGAGTGGTCTGCATGGGGGAGCTATGTCTCATCTCATCCTGAGGGCCAGCTCCACCGGATCCTCACTTTTCAGTGCG

ACGCCCACTTCTGGACACTGCCTTCAAGCTGGGATTTAAGGGTGGGAACCCCAGAACGGGGTGGGGGGTGGCTTGCATTTCGGCTGTCCAAAAAGAAGGC

TGTGTGGCATTGGAAGTGTAAGGCTCTGAGTTTTAATTCTGCTTTAGCTGTAAAATATGTGGGTCTCATTTTCCTTCTCTGTAATCAAAACTACTGGGAT

CCTTCCCAGTTTAGTTGTCTTAGCAGTCTTTGAGGGGAGGTGGATGGAAGGCTTAACCAGCAGCCACAGCCAGCCTGTCTGCCGGGAGCCCAGGAGCCAG

CTTGCAAAATCTTGAAAAGCCAACCCCTTCTTAGTAGTCAGCTGCCTGTGATCCTGAGAACTGCTGTCAAAACCTGTGTTTTCACTCTCAGTAAATTCAG

ACCTGTGACCTTT
Translation
MGTRQETGRETLEGG GLLPEEPGSPGDPEDPQRGSQAG - UNI33178 - GTPSSLALCGQRPMRKRLSAPEWQLSLTEGTGENGASPTRSASSSSA

GSLDLEVDELETPSDSEQLDSGHEFEWED - UNI33178 - DDLPRAEGLGASEAAERLGRGCVCDVAGEDGHRWRVFRTGQREQRVDMTIIEPYKKV

LSHGG - UNI33178 - GYHGDGLNAVILFASCYLPRSSIPNYTYIMEHLFR RLRKNLRALVVVHATWYVKAFLALVRPFIS SSKFTRKIRFLDSL

GELAQLISLEQVHIPEVVRQ QLDRDLHGSKGT

For any suggestions or comments, please send an email to unitrap@crg.es