Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028126 (Pip5k1a)
Chromosomal location
Chr 3: 94862452 - 94910797 (-)
Description
phosphatidylinositol-4-phosphate 5-kinase, type 1 alpha Gene [Source:MGI (curated);Acc:Pip5k1a-002]
RefSeq_dna
NM_008847 
RefSeq_peptide
NP_032873.2 
UniGene
Mm.402240 Mm.296409 
MGI
MGI:107929 
Uniprot/SWISSPROT
P70182 
Uniprot/SPTREMBL
Q3U917 
Human Ortholog
ENSG00000180764 (PIPSL)
Omim not available
UniTrap UNI16381
Vector Insertion
Chr 3: 94910297 - 94910746
Public Clones not available
Private Clones OST461947 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5111
Vector Insertion
Chr 3: 94910297 - 94910702
Public Clones RRI246 (baygenomics) CSI224 (baygenomics) XE248 (baygenomics) CSI256 (baygenomics)
RRA016 (baygenomics) YTC250 (baygenomics) A049A01 (ggtc) A026B08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14772
Vector Insertion
Chr 3: 94900964 - 94910702
Public Clones (ggtc) PST11211-NR (escells) PST15132-NL (escells) IST12065H10 (tigm)
Private Clones OST426918 (lexicon) OST336333 (lexicon) OST187383 (lexicon) OST107166 (lexicon)
OST71904 (lexicon) OST59844 (lexicon) OST42174 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33559
Vector Insertion
Chr 3: 94886712 - 94901241
Public Clones IST10077C2 (tigm) IST13948G10 (tigm) IST14857G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7094
Vector Insertion
Chr 3: 94886712 - 94886745
Public Clones RRI243 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18295
Vector Insertion
Chr 3: 94882105 - 94882411
Public Clones not available
Private Clones OST426235 (lexicon) OST159978 (lexicon) OST43713 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8229
Vector Insertion
Chr 3: 94878046 - 94882023
Public Clones RRF197 (baygenomics)
Private Clones OST249467 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8058
Vector Insertion
Chr 3: 94874934 - 94875811
Public Clones RRJ209 (baygenomics) RRJ208 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12515
Vector Insertion
Chr 3: 94871388 - 94871982
Public Clones W167A06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI932
Vector Insertion
Chr 3: 94869783 - 94871303
Public Clones BC0169 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI448
Vector Insertion
Chr 3: 94869342 - 94869366
Public Clones DC0148 (sanger) CSD327 (baygenomics) HMA542 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14950
Vector Insertion
Chr 3: 94868252 - 94869366
Public Clones PST6986-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10829
Vector Insertion
Chr 3: 94864452 - 94867576
Public Clones D031C08 (ggtc)
Private Clones OST67786 (lexicon) OST67764 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107229
Sequence
AGGCAGTGGCTGGGGAGGTGAGGGAGGGGGGGCATTCGCTTTTGGGGGCACCTCAGGTGCCTAGGTTTTCCTTTAGGTTTGTTCTATCCGAGACGCGGGA

CTCCCGGGGCCCGGCTCAAGTGTTCCTGTCTGGTAAGAGAAGGTAGCTTTGGCGGAGAGCAGTTCAAGTTGCTAGGAAGGTGCGAGACTGCAGCTCTCCC

CCATGCCGGGCAAGTGGTGCGGTCCTGAGCTTGTCCTGGAGCCTGAACAACGCCTGTGAGAAGCCCGCCGAACGCGGGTTCTGTGAAGAGACGTGGGGAA

GATTCGATTCCGAGAAAAGGAAAAGCCGGATTGAAAGGGAGCGAAGCCGCTGAGGGGGAGGGGGCTGCCAAGATGGCGTCCGCCTCCTCAGGGCCAGCGG

CGGCCGGGTTTTCATCCCTTGATGCCGGGGCCCCTGCTGGTACCGCAG - UNI5111 - - UNI14772 - - UNI16381 - - UNI33559 - 

CTGCTCCTGTGCTTCAGATGGATCCTGCTCCGGCTCCTGCAAATGCACCTCCTGCAAGAAAAGCTGCTGCTCCTGCTCTCAGGGCTGCATCTGCAAAGAC

GCTTCGGACAAGTGCAGCTGCTGCGCCTGAAGTGGGGGCATCCTCTCAACTGTGTAAATAGAATATGTAGAAACCTAGCCTTTTTGTACAACCCTGACCT

TTTGTACAACACCTTTTTCTATAAAGCATGTAACTGACAATAAAAAAAAGTTGACTTGATTTAAAAAAAAAAAAAA
Translation
MASASSGPAAAGFSSLDAGAPAGTAA - UNI5111 - - UNI14772 - - UNI16381 - - UNI33559 - AAPVLQMDPAPAPANAPPARKA

AAPALRAASAKTLRTSAAAAPEVGASSQLCK
Transcript ENSMUST00000107231
Sequence
CGGGGATAGGAGTTATGGATGCTGCTT - UNI18295 - GGACCTTCCGCCTCTGTCATGCCTGTTAAAAAAATAGGCCATCGAAGTGTTGATTCCTC

TGGAGAGACTACATACAAGAAG - UNI8229 - ACAACTTCATCAGCCTTGAAAGGTGCCATCCAGTTAGGCATCACTCACACTGTGGGCAGCCTGAG

CACCAAACCAGAGCGTGATGTCCTCATGCAAGACTTCTACGTGGTGGAGAGCATCTTTTTCCCCAG TGAAGGCAGCAACCTGACACCGGCTCACCATTA

CAATGACTTTCGATTCAAGACCTATGCGCCTGTTGCCTTCCGTTACTTCAGAGAGCTCTTTGGCATCCGGCCTGATGATTACTTG TACTCCCTTTGCAG

TGAGCCATTGATTGAACTCTCCAATTCTGGAGCTAGTGGTTCCCTCTTCTATGTGTCCAGTGATGATGAATTCATCATTAAGACCGTCCAGCATAAAGAA

GCAGAATTTCTGCAGAAGTTGCTTCCAGGATACTACATG - UNI8058 - GCGGCAAGAACATACGAATTGTGGTGATGAACAATCTCTTGCCTCGGT

CAGTCAAAATGCATATGAAATATGACCTGAAGGGTTCAACTTACAAGCGGCGGGCTTCTCAGAAAGAACGAGAG
Translation
MLL - UNI18295 - GPSASVMPVKKIGHRSVDSSGETTYKK - UNI8229 - TTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFP

S SEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYL YSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYM - UNI

8058 - AARTYELW
Transcript ENSMUST00000005768
Sequence
GGGGCACCTCAGGTGCCTAGGTTTTCCTTTAGGTTTGTTCTATCCGAGACGCGGGACTCCCGGGGCCCGGCTCAAGTGTTCCTGTCTGGTAAGAGAAGGT

AGCTTTGGCGGAGAGCAGTTCAAGTTGCTAGGAAGGTGCGAGACTGCAGCTCTCCCCCATGCCGGGCAAGTGGTGCGGTCCTGAGCTTGTCCTGGAGCCT

GAACAACGCCTGTGAGAAGCCCGCCGAACGCGGGTTCTGTGAAGAGACGTGGGGAAGATTCGATTCCGAGAAAAGGAAAAGCCGGATTGAAAGGGAGCGA

AGCCGCTGAGGGGGAGGGGGCTGCCAAGATGGCGTCCGCCTCCTCAGGGCCAGCGGCGGCCGGGTTTTCATCCCTTGATGCCGGGGCCCCTGCTGGTACC

GCAG - UNI5111 - - UNI7094 - - UNI14772 - - UNI16381 - - UNI33559 - CATCTGGAATCAAGAGAGCCACAGTATCTGAG

 - UNI7094 - - UNI18295 - - UNI33559 - GGACCTTCCGCCTCTGTCATGCCTGTTAAAAAAATAGGCCATCGAAGTGTTGATTCCTCTG

GAGAGACTACATACAAGAAG - UNI8229 - ACAACTTCATCAGCCTTGAAAGGTGCCATCCAGTTAGGCATCACTCACACTGTGGGCAGCCTGAGCA

CCAAACCAGAGCGTGATGTCCTCATGCAAGACTTCTACGTGGTGGAGAGCATCTTTTTCCCCAG TGAAGGCAGCAACCTGACACCGGCTCACCATTACA

ATGACTTTCGATTCAAGACCTATGCGCCTGTTGCCTTCCGTTACTTCAGAGAGCTCTTTGGCATCCGGCCTGATGATTACTTG TACTCCCTTTGCAGTG

AGCCATTGATTGAACTCTCCAATTCTGGAGCTAGTGGTTCCCTCTTCTATGTGTCCAGTGATGATGAATTCATCATTAAGACCGTCCAGCATAAAGAAGC

AGAATTTCTGCAGAAGTTGCTTCCAGGATACTACATG - UNI8058 - AATCTTAACCAAAACCCTCGTACTTTGCTGCCCAAATTTTATGGATTGTA

CTGTGTGCAAGCAGGCGGCAAGAACATACGAATTGTGGTGATGAACAATCTCTTGCCTCGGTCAGTCAAAATGCATATGAAATATGACCTGAAGGGTTCA

ACTTACAAGCGGCGGGCTTCTCAGAAAGAACGAGAGAAAACTCTCCCCACCTTTAAAGACCTGGACTTCCTACAAGATATCCCTGACGGCCTATTTTTGG

ATGCTGACATGTACAGTGCTCTGTGTAAGACTCTACAGCGTGACTGTTTG GTGCTGCAGAGCTTCAAGATAATGGACTACAGCCTGTTGATGTCCATCC

ACAACATGGACCATGCACAGAGGGAGCCCACGAGCAATGACACACAGTACTCGGCTGACACGCGCAGACCAGCCCCACAGAAGGCGCTCTATTCCACAGC

TATGGAATCCATCCAGGGCGAGGCTCGACGGGGCGGCACTGTGGAGACTGAGGACCA - UNI12515 - CATGGGTGGCATCCCTGCCCGGAATAACA

AAGGAGAAAGGCTCCTGCTTTATATTGGCATCATTGATATTCTTCAGTCCTACAG - UNI932 - GTTTGTTAAGAAGTTGGAGCACTCTTGGAAAGC

ACTGGTCCATGATGGG GATACGGTGTCAGTGCATCGTCCAGGCTTCTATGCTGAGCGGTTCCAGCGTTTCATGTGCAACACAGTGTTCAAGAAGATTCC

CT - UNI448 - - UNI14950 - TGAAGCCTTCTCCTACCAAAAAGTTTCGGTCTGGCCCGTCTTTCTCTCGGCGATCAGGCCCCAGCGGCAACTC

CTGCACCTCCCAGCTGATGGCCTCTGGGGAACACAGAGCACAAGTGACCACCAAGGCGGAAGTGGAGCCAG - UNI14950 - ATGTACACCTTGGGC

GTCCTGATGTCTTACCTCAGACTCCACCTTTGGAGGAAATAAGTGAGGGTTCACCTGTTCCTGGCCCCAGTTTCTCACCTGTAGTTGGACAACCTTTGCA

AATACTAAATTTGAG - UNI10829 - TTCAACCTTGGAAAAGCTTGATGTTGCAGAGTCAGAGTTCACCCAC TGAGCAGTGAGCCTCAGAAGACCT

GAAACAAGACTCTGCTGTCGCTTTGATCCCAAGATGTCAGCCCTTGCCCCAGGAATGCTGAATCGTCTTCTTGGTCATCAACAGAGGAGAGAATGTGGAG

CTAGCAGGGCTCTGACACTGTCTCCCCTTCCTCTGGGCAGTAGTGCCTTTGACAGTTGAGGACAGCATCGTCCCCACCACTCCAGAAGTGGGTGGCGTGA

ATTTTCCACTGCCTGCCATGGCTTCTATAGCTGAATATTTTTCAAACCCCCATTCTTTGTGCTGACATGGGGTTGCTGGACTGGTGGTTTCCTCCTGTTT

ACCTTTCTCCTGGAGCTGGACTCTTCATTTCCTCAGGACGGACTGGCTGGACATTGTTCCTGCCTTGGCTCTCCCGCTGGTCTTTGGAGACTCCCAATGA

TTTGTATAAAGGTGTTTGGGGGAAAGTAAGGATCATCCTTACTCCCAACCTTCTTTTCCTTAAAAAAGGAAAAAAAAAAAAAAAAAAAACACAAAGAGCA

CACAATGTAAATTTGAGCCAGTCTCAGATAAAAGTTCTCTAAGTGTTGTAGAAGAGCCCTAGTGTTTGTGAAGCAGAAAGGCTGGGGCTGCCCCACCAGC

AGCTGCTCTCTGACTCCCTCACTTAGGGTTGAGGGAATAGAGAGGGCCTGGCCCTTTTTTAAGACAAAGGGGCAGCCATGTTAGGAGAGTGGACCTTAGC

AGGACCCTACTCACTGCCAGGTCTTCGGTTATTACTATTCTGCAATTTGGAATGTATCCTCATAGTTTTTTCTAGATATAAAGAATTATCAAATGATTTT

AGACCATTCTCCAAAGGAGATTTCTTTGTTCTTCCTATATTTTCCAACAGTATTCTGCTCTTTGTGGAGCTACGGTGGAGGGAGATGTTTGTGTCTGTTT

AACAGGCAGTCTGTATCTATGAGGCTAGAGAATATTTTCTTAAACTCCTAGGGAGCCACAGACTTCCCTCTGTACGGTTGTCGCCATGTCACCTGGCCTG

CCCTTACTCTGCAGAGAAGCTGGAAATGGGGCCACGGAGCCCTCTCCTTCCTCTCAGTTGTGGCCCATCTGGTCCTGGCTGGTGGGGCAGTGCATGGTGT

TTCAGGCTGGCTGTTGAAATCCCACATTAGTTCCTTCCCTGTCCCGTCCCACCTTGATAGCAGGTTAGCCAACCCCCACGTAACTGTCTATATTAGACAC

CCCCAGCCACCTTCTGGCTGCCTGTCTTTGCTGCCATGTTCTTTTTTACAAGAAGGAAACAAACAATTTCTTGCTATTTTTTTTTCATAATTTACTATTT

ATGATGTATTTAAGTGTTTTATTCAGGACAGGGTTCTGTAAGGGGTGGGAGGGAGTATTTGAGGGAGGGCTGGGACTTAGGGAAAGGACATGGGATTCAA

CATTTTTATGGAGTGTTACTATTTGCCTCTACTTTGTATTGTTGAAAAATGACAGATGCAATATAAAAGTAATAAATATCTGGTTTTAATGTA
Translation
MASASSGPAAAGFSSLDAGAPAGTAA - UNI5111 - - UNI7094 - - UNI14772 - - UNI16381 - - UNI33559 - ASGIKRATVS

E - UNI7094 - - UNI18295 - - UNI33559 - GPSASVMPVKKIGHRSVDSSGETTYKK - UNI8229 - TTSSALKGAIQLGITHTVGS

LSTKPERDVLMQDFYVVESIFFPS SEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYL YSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTV

QHKEAEFLQKLLPGYYM - UNI8058 - NLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKD

LDFLQDIPDGLFLDADMYSALCKTLQRDCL VLQSFKIMDYSLLMSIHNMDHAQREPTSNDTQYSADTRRPAPQKALYSTAMESIQGEARRGGTVETEDH

 - UNI12515 - HMGGIPARNNKGERLLLYIGIIDILQSYR - UNI932 - RFVKKLEHSWKALVHDG DTVSVHRPGFYAERFQRFMCNTVFKKI

PL - UNI448 - - UNI14950 - LKPSPTKKFRSGPSFSRRSGPSGNSCTSQLMASGEHRAQVTTKAEVEPD - UNI14950 - DVHLGRPDVL

PQTPPLEEISEGSPVPGPSFSPVVGQPLQILNLS - UNI10829 - SSTLEKLDVAESEFTH H
Transcript ENSMUST00000107232
Sequence
ACCCTGAGCCGAGCGGTGGAGTTGGGGATAAACAGGCAGTGGCTGGGGAGGTGAGGGAGGGGGGGCATTCGCTTTTGGGGGCACCTCAGGTGCCTAGGTT

TTCCTTTAGGTTTGTTCTATCCGAGACGCGGGACTCCCGGGGCCCGGCTCAAGTGTTCCTGTCTGGTAAGAGAAGGTAGCTTTGGCGGAGAGCAGTTCAA

GTTGCTAGGAAGGTGCGAGACTGCAGCTCTCCCCCATGCCGGGCAAGTGGTGCGGTCCTGAGCTTGTCCTGGAGCCTGAACAACGCCTGTGAGAAGCCCG

CCGAACGCGGGTTCTGTGAAGAGACGTGGGGAAGATTCGATTCCGAGAAAAGGAAAAGCCGGATTGAAAGGGAGCGAAGCCGCTGAGGGGGAGGGGGCTG

CCAAGATGGCGTCCGCCTCCTCAGGGCCAGCGGCGGCCGGGTTTTCATCCCTTGATGCCGGGGCCCCTGCTGGTACCGCAG - UNI5111 - - UNI1

4772 - - UNI16381 - - UNI33559 - CAGCAGCATCTGGAATCAAGAGAGCCACAGTATCTGAG - UNI7094 - - UNI18295 - - U

NI33559 - GGACCTTCCGCCTCTGTCATGCCTGTTAAAAAAATAGGCCATCGAAGTGTTGATTCCTCTGGAGAGACTACATACAAGAAG - UNI822

9 - ACAACTTCATCAGCCTTGAAAGGTGCCATCCAGTTAGGCATCACTCACACTGTGGGCAGCCTGAGCACCAAACCAGAGCGTGATGTCCTCATGCAA

GACTTCTACGTGGTGGAGAGCATCTTTTTCCCCAG TGAAGGCAGCAACCTGACACCGGCTCACCATTACAATGACTTTCGATTCAAGACCTATGCGCCT

GTTGCCTTCCGTTACTTCAGAGAGCTCTTTGGCATCCGGCCTGATGATTACTTG TACTCCCTTTGCAGTGAGCCATTGATTGAACTCTCCAATTCTGGA

GCTAGTGGTTCCCTCTTCTATGTGTCCAGTGATGATGAATTCATCATTAAGACCGTCCAGCATAAAGAAGCAGAATTTCTGCAGAAGTTGCTTCCAGGAT

ACTACATG - UNI8058 - AATCTTAACCAAAACCCTCGTACTTTGCTGCCCAAATTTTATGGATTGTACTGTGTGCAAGCAGGCGGCAAGAACATAC

GAATTGTGGTGATGAACAATCTCTTGCCTCGGTCAGTCAAAATGCATATGAAATATGACCTGAAGGGTTCAACTTACAAGCGGCGGGCTTCTCAGAAAGA

ACGAGAGAAAACTCTCCCCACCTTTAAAGACCTGGACTTCCTACAAGATATCCCTGACGGCCTATTTTTGGATGCTGACATGTACAGTGCTCTGTGTAAG

ACTCTACAGCGTGACTGTTTG GTGCTGCAGAGCTTCAAGATAATGGACTACAGCCTGTTGATGTCCATCCACAACATGGACCATGCACAGAGGGAGCCC

ACGAGCAATGACACACAGTACTCGGCTGACACGCGCAGACCAGCCCCACAGAAGGCGCTCTATTCCACAGCTATGGAATCCATCCAGGGCGAGGCTCGAC

GGGGCGGCACTGTGGAGACTGAGGACCA - UNI12515 - CATGGGTGGCATCCCTGCCCGGAATAACAAAGGAGAAAGGCTCCTGCTTTATATTGGC

ATCATTGATATTCTTCAGTCCTACAG - UNI932 - GTTTGTTAAGAAGTTGGAGCACTCTTGGAAAGCACTGGTCCATGATGGG GATACGGTGTCA

GTGCATCGTCCAGGCTTCTATGCTGAGCGGTTCCAGCGTTTCATGTGCAACACAGTGTTCAAGAAGATTCCCT - UNI448 - - UNI14950 - AT

GTACACCTTGGGCGTCCTGATGTCTTACCTCAGACTCCACCTTTGGAGGAAATAAGTGAGGGTTCACCTGTTCCTGGCCCCAGTTTCTCACCTGTAGTTG

GACAACCTTTGCAAATACTAAATTTGAG - UNI10829 - TTCAACCTTGGAAAAGCTTGATGTTGCAGAGTCAGAGTTCACCCAC TGAGCAGTGAG

CCTCAGAAGACCTGAAACAAGACTCTGCTGTCGCTTTGATCCCAAGATGTCAGCCCTTGCCCCAGGAATGCTGAATCGTCTTCTTGGTCATCAACAGAGG

AGAGAATGTGGAGCTAGCAGGGCTCTGACACTGTCTCCCCTTCCTCTGGGCAGTAGTGCCTTTGACAGTTGAGGACAGCATCGTCCCCACCACTCCAGAA

GTGGGTGGCGTGAATTTTCCACTGCCTGCCATGGCTTCTATAGCTGAATATTTTTCAAACCCCCATTCTTTGTGCTGACATGGGGTTGCTGGACTGGTGG

TTTCCTCCTGTTTACCTTTCTCCTGGAGCTGGACTCTTCATTTCCTCAGGACGGACTGGCTGGACATTGTTCCTGCCTTGGCTCTCCCGCTGGTCTTTGG

AGACTCCCAATGATTTGTATAAAGGTGTTTGGGGGAAAGTAAGGATCATCCTTACTCCCAACCTTCTTTTCCTTAAAAAAGGAAAAAAAAAAAAAAAAAA

AACACAAAGAGCACACAATGTAAATTTGAGCCAGTCTCAGATAAAAGTTCTCTAAGTGTTGTAGAAGAGCCCTAGTGTTTGTGAAGCAGAAAGGCTGGGG

CTGCCCCACCAGCAGCTGCTCTCTGACTCCCTCACTTAGGGTTGAGGGAATAGAGAGGGCCTGGCCCTTTTTTAAGACAAAGGGGCAGCCATGTTAGGAG

AGTGGACCTTAGCAGGACCCTACTCACTGCCAGGTCTTCGGTTATTACTATTCTGCAATTTGGAATGTATCCTCATAGTTTTTTCTAGATATAAAGAATT

ATCAAATGATTTTAGACCATTCTCCAAAGGAGATTTCTTTGTTCTTCCTATATTTTCCAACAGTATTCTGCTCTTTGTGGAGCTACGGTGGAGGGAGATG

TTTGTGTCTGTTTAACAGGCAGTCTGTATCTATGAGGCTAGAGAATATTTTCTTAAACTCCTAGGGAGCCACAGACTTCCCTCTGTACGGTTGTCGCCAT

GTCACCTGGCCTGCCCTTACTCTGCAGAGAAGCTGGAAATGGGGCCACGGAGCCCTCTCCTTCCTCTCAGTTGTGGCCCATCTGGTCCTGGCTGGTGGGG

CAGTGCATGGTGTTTCAGGCTGGCTGTTGAAATCCCACATTAGTTCCTTCCCTGTCCCGTCCCACCTTGATAGCAGGTTAGCCAACCCCCACGTAACTGT

CTATATTAGACACCCCCAGCCACCTTCTGGCTGCCTGTCTTTGCTGCCATGTTCTTTTTTACAAGAAGGAAACAAACAATTTCTTGCTATTTTTTTTTCA

TAATTTACTATTTATGATGTATTTAAGTGTTTTATTCAGGACAGGGTTCTGTAAGGGGTGGGAGGGAGTATTTGAGGGAGGGCTGGGACTTAGGGAAAGG

ACATGGGATTCAACATTTTTATGGAGTGTTACTATTTGCCTCTACTTTGTATTGTTGAAAAATGACAGATGCAATATAAAAGTAATAAATATCTGGTTTT

AATGTATTAAAGTTCTAGCAATCATTTAGA
Translation
MASASSGPAAAGFSSLDAGAPAGTAA - UNI5111 - - UNI14772 - - UNI16381 - - UNI33559 - AAASGIKRATVSE - UNI709

4 - - UNI18295 - - UNI33559 - GPSASVMPVKKIGHRSVDSSGETTYKK - UNI8229 - TTSSALKGAIQLGITHTVGSLSTKPERDVL

MQDFYVVESIFFPS SEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYL YSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQK

LLPGYYM - UNI8058 - NLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDG

LFLDADMYSALCKTLQRDCL VLQSFKIMDYSLLMSIHNMDHAQREPTSNDTQYSADTRRPAPQKALYSTAMESIQGEARRGGTVETEDH - UNI1251

5 - HMGGIPARNNKGERLLLYIGIIDILQSYR - UNI932 - RFVKKLEHSWKALVHDG DTVSVHRPGFYAERFQRFMCNTVFKKIPY - UNI44

8 - - UNI14950 - YVHLGRPDVLPQTPPLEEISEGSPVPGPSFSPVVGQPLQILNLS - UNI10829 - SSTLEKLDVAESEFTH H
Transcript ENSMUST00000107233
Sequence
GGGGTTTCCTTGGCCGCCCACCCTGAGCCGAGCGGTGGAGTTGGGGATAAACAGGCAGTGGCTGGGGAGGTGAGGGAGGGGGGGCATTCGCTTTTGGGGG

CACCTCAGGTGCCTAGGTTTTCCTTTAGGTTTGTTCTATCCGAGACGCGGGACTCCCGGGGCCCGGCTCAAGTGTTCCTGTCTGGTAAGAGAAGGTAGCT

TTGGCGGAGAGCAGTTCAAGTTGCTAGGAAGGTGCGAGACTGCAGCTCTCCCCCATGCCGGGCAAGTGGTGCGGTCCTGAGCTTGTCCTGGAGCCTGAAC

AACGCCTGTGAGAAGCCCGCCGAACGCGGGTTCTGTGAAGAGACGTGGGGAAGATTCGATTCCGAGAAAAGGAAAAGCCGGATTGAAAGGGAGCGAAGCC

GCTGAGGGGGAGGGGGCTGCCAAGATGGCGTCCGCCTCCTCAGGGCCAGCGGCGGCCGGGTTTTCATCCCTTGATGCCGGGGCCCCTGCTGGTACCGCAG

 - UNI5111 - - UNI14772 - - UNI16381 - - UNI33559 - CAGCATCTGGAATCAAGAGAGCCACAGTATCTGAG - UNI7094 - 

- UNI18295 - - UNI33559 - GGACCTTCCGCCTCTGTCATGCCTGTTAAAAAAATAGGCCATCGAAGTGTTGATTCCTCTGGAGAGACTACATA

CAAGAAG - UNI8229 - ACAACTTCATCAGCCTTGAAAGGTGCCATCCAGTTAGGCATCACTCACACTGTGGGCAGCCTGAGCACCAAACCAGAGCG

TGATGTCCTCATGCAAGACTTCTACGTGGTGGAGAGCATCTTTTTCCCCAG TGAAGGCAGCAACCTGACACCGGCTCACCATTACAATGACTTTCGATT

CAAGACCTATGCGCCTGTTGCCTTCCGTTACTTCAGAGAGCTCTTTGGCATCCGGCCTGATGATTACTTG TACTCCCTTTGCAGTGAGCCATTGATTGA

ACTCTCCAATTCTGGAGCTAGTGGTTCCCTCTTCTATGTGTCCAGTGATGATGAATTCATCATTAAGACCGTCCAGCATAAAGAAGCAGAATTTCTGCAG

AAGTTGCTTCCAGGATACTACATG - UNI8058 - AATCTTAACCAAAACCCTCGTACTTTGCTGCCCAAATTTTATGGATTGTACTGTGTGCAAGCA

GGCGGCAAGAACATACGAATTGTGGTGATGAACAATCTCTTGCCTCGGTCAGTCAAAATGCATATGAAATATGACCTGAAGGGTTCAACTTACAAGCGGC

GGGCTTCTCAGAAAGAACGAGAGAAAACTCTCCCCACCTTTAAAGACCTGGACTTCCTACAAGATATCCCTGACGGCCTATTTTTGGATGCTGACATGTA

CAGTGCTCTGTGTAAGACTCTACAGCGTGACTGTTTG GTGCTGCAGAGCTTCAAGATAATGGACTACAGCCTGTTGATGTCCATCCACAACATGGACCA

TGCACAGAGGGAGCCCACGAGCAATGACACACAGTACTCGGCTGACACGCGCAGACCAGCCCCACAGAAGGCGCTCTATTCCACAGCTATGGAATCCATC

CAGGGCGAGGCTCGACGGGGCGGCACTGTGGAGACTGAGGACCA - UNI12515 - CATGGGTGGCATCCCTGCCCGGAATAACAAAGGAGAAAGGCT

CCTGCTTTATATTGGCATCATTGATATTCTTCAGTCCTACAG - UNI932 - GTTTGTTAAGAAGTTGGAGCACTCTTGGAAAGCACTGGTCCATGAT

GGG GATACGGTGTCAGTGCATCGTCCAGGCTTCTATGCTGAGCGGTTCCAGCGTTTCATGTGCAACACAGTGTTCAAGAAGATTCCCT - UNI448 -

 - UNI14950 - TGAAGCCTTCTCCTACCAAAAAGTTTCGGTCTGGCCCGTCTTTCTCTCGGCGATCAGGCCCCAGCGGCAACTCCTGCACCTCCCAG

CTGATGGCCTCTGGGGAACACAGAGCACAAGTGACCACCAAGGCGGAAGTGGAGCCAG - UNI14950 - ATGTACACCTTGGGCGTCCTGATGTCTT

ACCTCAGACTCCACCTTTGGAGGAAATAAGTGAGGGTTCACCTGTTCCTGGCCCCAGTTTCTCACCTGTAGTTGGACAACCTTTGCAAATACTAAATTTG

AG - UNI10829 - TTCAACCTTGGAAAAGCTTGATGTTGCAGAGTCAGAGTTCACCCAC TGAGCAGTGAGCCTCAGAAGACCTGAAACAAGACTCT

GCTGTCGCTTTGATCCCAAGATGTCAGCCCTTGCCCCAGGAATGCTGAATCGTCTTCTTGGTCATCAACAGAGGAGAGAATGTGGAGCTAGCAGGGCTCT

GACACTGTCTCCCCTTCCTCTGGGCAGTAGTGCCTTTGACAGTTGAGGACAGCATCGTCCCCACCACTCCAGAAGTGGGTGGCGTGAATTTTCCACTGCC

TGCCATGGCTTCTATAGCTGAATATTTTTCAAACCCCCATTCTTTGTGCTGACATGGGGTTGCTGGACTGGTGGTTTCCTCCTGTTTACCTTTCTCCTGG

AGCTGGACTCTTCATTTCCTCAGGACGGACTGGCTGGACATTGTTCCTGCCTTGGCTCTCCCGCTGGTCTTTGGAGACTCCCAATGATTTGTATAAAGGT

GTTTGGGGGAAAGTAAGGATCATCCTTACTCCCAACCTTCTTTTCCTTAAAAAAGGAAAAAAAAAAAAAAAAAAAACACAAAGAGCACACAATGTAAATT

TGAGCCAGTCTCAGATAAAAGTTCTCTAAGTGTTGTAGAAGAGCCCTAGTGTTTGTGAAGCAGAAAGGCTGGGGCTGCCCCACCAGCAGCTGCTCTCTGA

CTCCCTCACTTAGGGTTGAGGGAATAGAGAGGGCCTGGCCCTTTTTTAAGACAAAGGGGCAGCCATGTTAGGAGAGTGGACCTTAGCAGGACCCTACTCA

CTGCCAGGTCTTCGGTTATTACTATTCTGCAATTTGGAATGTATCCTCATAGTTTTTTCTAGATATAAAGAATTATCAAATGATTTTAGACCATTCTCCA

AAGGAGATTTCTTTGTTCTTCCTATATTTTCCAACAGTATTCTGCTCTTTGTGGAGCTACGGTGGAGGGAGATGTTTGTGTCTGTTTAACAGGCAGTCTG

TATCTATGAGGCTAGAGAATATTTTCTTAAACTCCTAGGGAGCCACAGACTTCCCTCTGTACGGTTGTCGCCATGTCACCTGGCCTGCCCTTACTCTGCA

GAGAAGCTGGAAATGGGGCCACGGAGCCCTCTCCTTCCTCTCAGTTGTGGCCCATCTGGTCCTGGCTGGTGGGGCAGTGCATGGTGTTTCAGGCTGGCTG

TTGAAATCCCACATTAGTTCCTTCCCTGTCCCGTCCCACCTTGATAGCAGGTTAGCCAACCCCCACGTAACTGTCTATATTAGACACCCCCAGCCACCTT

CTGGCTGCCTGTCTTTGCTGCCATGTTCTTTTTTACAAGAAGGAAACAAACAATTTCTTGCTATTTTTTTTTCATAATTTACTATTTATGATGTATTTAA

GTGTTTTATTCAGGACAGGGTTCTGTAAGGGGTGGGAGGGAGTATTTGAGGGAGGGCTGGGACTTAGGGAAAGGACATGGGATTCAACATTTTTATGGAG

TGTTACTATTTGCCTCTACTTTGTATTGTTGAAAAATGACAGATGCAATATAAAAGTAATAAATATCTGGTTTTAATGTATTAAAGTTCTAGCAATCATT

TAGACCTATTTTTAAATGC
Translation
MASASSGPAAAGFSSLDAGAPAGTAA - UNI5111 - - UNI14772 - - UNI16381 - - UNI33559 - AASGIKRATVSE - UNI7094

 - - UNI18295 - - UNI33559 - GPSASVMPVKKIGHRSVDSSGETTYKK - UNI8229 - TTSSALKGAIQLGITHTVGSLSTKPERDVLM

QDFYVVESIFFPS SEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYL YSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKL

LPGYYM - UNI8058 - NLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGL

FLDADMYSALCKTLQRDCL VLQSFKIMDYSLLMSIHNMDHAQREPTSNDTQYSADTRRPAPQKALYSTAMESIQGEARRGGTVETEDH - UNI12515

 - HMGGIPARNNKGERLLLYIGIIDILQSYR - UNI932 - RFVKKLEHSWKALVHDG DTVSVHRPGFYAERFQRFMCNTVFKKIPL - UNI448

 - - UNI14950 - LKPSPTKKFRSGPSFSRRSGPSGNSCTSQLMASGEHRAQVTTKAEVEPD - UNI14950 - DVHLGRPDVLPQTPPLEEISE

GSPVPGPSFSPVVGQPLQILNLS - UNI10829 - SSTLEKLDVAESEFTH H
Transcript ENSMUST00000107235
Sequence
GGGGTTTCCTTGGCCGCCCACCCTGAGCCGAGCGGTGGAGTTGGGGATAAACAGGCAGTGGCTGGGGAGGTGAGGGAGGGGGGGCATTCGCTTTTGGGGG

CACCTCAGGTGCCTAGGTTTTCCTTTAGGTTTGTTCTATCCGAGACGCGGGACTCCCGGGGCCCGGCTCAAGTGTTCCTGTCTGGTAAGAGAAGGTAGCT

TTGGCGGAGAGCAGTTCAAGTTGCTAGGAAGGTGCGAGACTGCAGCTCTCCCCCATGCCGGGCAAGTGGTGCGGTCCTGAGCTTGTCCTGGAGCCTGAAC

AACGCCTGTGAGAAGCCCGCCGAACGCGGGTTCTGTGAAGAGACGTGGGGAAGATTCGATTCCGAGAAAAGGAAAAGCCGGATTGAAAGGGAGCGAAGCC

GCTGAGGGGGAGGGGGCTGCCAAGATGGCGTCCGCCTCCTCAGGGCCAGCGGCGGCCGGGTTTTCATCCCTTGATGCCGGGGCCCCTGCTGGTACCGCAG

 - UNI5111 - - UNI14772 - - UNI16381 - - UNI33559 - CAGCATCTGGAATCAAGAGAGCCACAGTATCTGAG - UNI7094 - 

- UNI18295 - - UNI33559 - GGACCTTCCGCCTCTGTCATGCCTGTTAAAAAAATAGGCCATCGAAGTGTTGATTCCTCTGGAGAGACTACATA

CAAGAAG - UNI8229 - ACAACTTCATCAGCCTTGAAAGGTGCCATCCAGTTAGGCATCACTCACACTGTGGGCAGCCTGAGCACCAAACCAGAGCG

TGATGTCCTCATGCAAGACTTCTACGTGGTGGAGAGCATCTTTTTCCCCAG TGAAGGCAGCAACCTGACACCGGCTCACCATTACAATGACTTTCGATT

CAAGACCTATGCGCCTGTTGCCTTCCGTTACTTCAGAGAGCTCTTTGGCATCCGGCCTGATGATTACTTG TACTCCCTTTGCAGTGAGCCATTGATTGA

ACTCTCCAATTCTGGAGCTAGTGGTTCCCTCTTCTATGTGTCCAGTGATGATGAATTCATCATTAAGACCGTCCAGCATAAAGAAGCAGAATTTCTGCAG

AAGTTGCTTCCAGGATACTACATG - UNI8058 - AATCTTAACCAAAACCCTCGTACTTTGCTGCCCAAATTTTATGGATTGTACTGTGTGCAAGCA

GGCGGCAAGAACATACGAATTGTGGTGATGAACAATCTCTTGCCTCGGTCAGTCAA - UNI448 - - UNI932 - - UNI12515 - - UNI149

50 - CACAGTGTTCAAGAAGATTCCCT - UNI448 - - UNI14950 - TGAAGCCTTCTCCTACCAAAAAGTTTCGGTCTGGCCCGTCTTTCTCT

CGGCGATCAGGCCCCAGCGGCAACTCCTGCACCTCCCAGCTGATGGCCTCTGGGGAACACAGAGCACAAGTGACCACCAAGGCGGAAGTGGAGCCAG - 

UNI14950 - ATGTACACCTTGGGCGTCCTGATGTCTTACCTCAGACTCCACCTTTGGAGGAAATAAGTGAGGGTTCACCTGTTCCTGGCCCCAGTTTC

TCACCTGTAGTTGGACAACCTTTGCAAATACTAAATTTGAG - UNI10829 - TTCAACCTTGGAAAAGCTTGATGTTGCAGAGTCAGAGTTCACCCA

C TGAGCAGTGAGCCTCAGAAGACCTGAAACAAGACTCTGCTGTCGCTTTGATCCCAAGATGTCAGCCCTTGCCCCAGGAATGCTGAATCGTCTTCTTGG

TCATCAACAGAGGAGAGAATGTGGAGCTAGCAGGGCTCTGACACTGTCTCCCCTTCCTCTGGGCAGTAGTGCCTTTGACAGTTGAGGACAGCATCGTCCC

CACCACTCCAGAAGTGGGTGGCGTGAATTTTCCACTGCCTGCCATGGCTTCTATAGCTGAATATTTTTCAAACCCCCATTCTTTGTGCTGACATGGGGTT

GCTGGACTGGTGGTTTCCTCCTGTTTACCTTTCTCCTGGAGCTGGACTCTTCATTTCCTCAGGACGGACTGGCTGGACATTGTTCCTGCCTTGGCTCTCC

CGCTGGTCTTTGGAGACTCCCAATGATTTGTATAAAGGTGTTTGGGGGAAAGTAAGGATCATCCTTACTCCCAACCTTCTTTTCCTTAAAAAAGGAAAAA

AAAAAAAAAAAAAAACACAAAGAGCACACAATGTAAATTTGAGCCAGTCTCAGATAAAAGTTCTCTAAGTGTTGTAGAAGAGCCCTAGTGTTTGTGAAGC

AGAAAGGCTGGGGCTGCCCCACCAGCAGCTGCTCTCTGACTCCCTCACTTAGGGTTGAGGGAATAGAGAGGGCCTGGCCCTTTTTTAAGACAAAGGGGCA

GCCATGTTAGGAGAGTGGACCTTAGCAGGACCCTACTCACTGCCAGGTCTTCGGTTATTACTATTCTGCAATTTGGAATGTATCCTCATAGTTTTTTCTA

GATATAAAGAATTATCAAATGATTTTAGACCATTCTCCAAAGGAGATTTCTTTGTTCTTCCTATATTTTCCAACAGTATTCTGCTCTTTGTGGAGCTACG

GTGGAGGGAGATGTTTGTGTCTGTTTAACAGGCAGTCTGTATCTATGAGGCTAGAGAATATTTTCTTAAACTCCTAGGGAGCCACAGACTTCCCTCTGTA

CGGTTGTCGCCATGTCACCTGGCCTGCCCTTACTCTGCAGAGAAGCTGGAAATGGGGCCACGGAGCCCTCTCCTTCCTCTCAGTTGTGGCCCATCTGGTC

CTGGCTGGTGGGGCAGTGCATGGTGTTTCAGGCTGGCTGTTGAAATCCCACATTAGTTCCTTCCCTGTCCCGTCCCACCTTGATAGCAGGTTAGCCAACC

CCCACGTAACTGTCTATATTAGACACCCCCAGCCACCTTCTGGCTGCCTGTCTTTGCTGCCATGTTCTTTTTTACAAGAAGGAAACAAACAATTTCTTGC

TATTTTTTTTTCATAATTTACTATTTATGATGTATTTAAGTGTTTTATTCAGGACAGGGTTCTGTAAGGGGTGGGAGGGAGTATTTGAGGGAGGGCTGGG

ACTTAGGGAAAGGACATGGGATTCAACATTTTTATGGAGTGTTACTATTTGCCTCTACTTTGTATTGTTGAAAAATGACAGATGCAATATAAAAGTAATA

AATATCTGGTTTTAAT
Translation
MASASSGPAAAGFSSLDAGAPAGTAA - UNI5111 - - UNI14772 - - UNI16381 - - UNI33559 - AASGIKRATVSE - UNI7094

 - - UNI18295 - - UNI33559 - GPSASVMPVKKIGHRSVDSSGETTYKK - UNI8229 - TTSSALKGAIQLGITHTVGSLSTKPERDVLM

QDFYVVESIFFPS SEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYL YSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKL

LPGYYM - UNI8058 - NLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVN - UNI448 - - UNI932 - - UNI12515 - - UNI

14950 - NTVFKKIPL - UNI448 - - UNI14950 - LKPSPTKKFRSGPSFSRRSGPSGNSCTSQLMASGEHRAQVTTKAEVEPD - UNI149

50 - DVHLGRPDVLPQTPPLEEISEGSPVPGPSFSPVVGQPLQILNLS - UNI10829 - SSTLEKLDVAESEFTH H
Transcript ENSMUST00000107236
Sequence
GGGGTTTCCTTGGCCGCCCACCCTGAGCCGAGCGGTGGAGTTGGGGATAAACAGGCAGTGGCTGGGGAGGTGAGGGAGGGGGGGCATTCGCTTTTGGGGG

CACCTCAGGTGCCTAGGTTTTCCTTTAGGTTTGTTCTATCCGAGACGCGGGACTCCCGGGGCCCGGCTCAAGTGTTCCTGTCTGGTAAGAGAAGGTAGCT

TTGGCGGAGAGCAGTTCAAGTTGCTAGGAAGGTGCGAGACTGCAGCTCTCCCCCATGCCGGGCAAGTGGTGCGGTCCTGAGCTTGTCCTGGAGCCTGAAC

AACGCCTGTGAGAAGCCCGCCGAACGCGGGTTCTGTGAAGAGACGTGGGGAAGATTCGATTCCGAGAAAAGGAAAAGCCGGATTGAAAGGGAGCGAAGCC

GCTGAGGGGGAGGGGGCTGCCAAGATGGCGTCCGCCTCCTCAGGGCCAGCGGCGGCCGGGTTTTCATCCCTTGATGCCGGGGCCCCTGCTGGTACCGCAG

 - UNI5111 - - UNI14772 - - UNI16381 - - UNI33559 - CAGCAGCATCTGGAATCAAGAGAGCCACAGTATCTGAG - UNI7094

 - - UNI18295 - - UNI33559 - GGACCTTCCGCCTCTGTCATGCCTGTTAAAAAAATAGGCCATCGAAGTGTTGATTCCTCTGGAGAGACTAC

ATACAAGAAG - UNI8229 - ACAACTTCATCAGCCTTGAAAGGTGCCATCCAGTTAGGCATCACTCACACTGTGGGCAGCCTGAGCACCAAACCAGA

GCGTGATGTCCTCATGCAAGACTTCTACGTGGTGGAGAGCATCTTTTTCCCCAG TGAAGGCAGCAACCTGACACCGGCTCACCATTACAATGACTTTCG

ATTCAAGACCTATGCGCCTGTTGCCTTCCGTTACTTCAGAGAGCTCTTTGGCATCCGGCCTGATGATTACTTG TACTCCCTTTGCAGTGAGCCATTGAT

TGAACTCTCCAATTCTGGAGCTAGTGGTTCCCTCTTCTATGTGTCCAGTGATGATGAATTCATCATTAAGACCGTCCAGCATAAAGAAGCAGAATTTCTG

CAGAAGTTGCTTCCAGGATACTACATG - UNI8058 - AATCTTAACCAAAACCCTCGTACTTTGCTGCCCAAATTTTATGGATTGTACTGTGTGCAA

GCAGGCGGCAAGAACATACGAATTGTGGTGATGAACAATCTCTTGCCTCGGTCAGTCAAAATGCATATGAAATATGACCTGAAGGGTTCAACTTACAAGC

GGCGGGCTTCTCAGAAAGAACGAGAGAAAACTCTCCCCACCTTTAAAGACCTGGACTTCCTACAAGATATCCCTGACGGCCTATTTTTGGATGCTGACAT

GTACAGTGCTCTGTGTAAGACTCTACAGCGTGACTGTTTG GTGCTGCAGAGCTTCAAGATAATGGACTACAGCCTGTTGATGTCCATCCACAACATGGA

CCATGCACAGAGGGAGCCCACGAGCAATGACACACAGTACTCGGCTGACACGCGCAGACCAGCCCCACAGAAGGCGCTCTATTCCACAGCTATGGAATCC

ATCCAGGGCGAGGCTCGACGGGGCGGCACTGTGGAGACTGAGGACCA - UNI12515 - CATGGGTGGCATCCCTGCCCGGAATAACAAAGGAGAAAG

GCTCCTGCTTTATATTGGCATCATTGATATTCTTCAGTCCTACAG - UNI932 - GTTTGTTAAGAAGTTGGAGCACTCTTGGAAAGCACTGGTCCAT

GATGGG GATACGGTGTCAGTGCATCGTCCAGGCTTCTATGCTGAGCGGTTCCAGCGTTTCATGTGCAACACAGTGTTCAAGAAGATTCCCT - UNI44

8 - - UNI14950 - TGAAGCCTTCTCCTACCAAAAAGTTTCGGTCTGGCCCGTCTTTCTCTCGGCGATCAGGCCCCAGCGGCAACTCCTGCACCTCC

CAGCTGATGGCCTCTGGGGAACACAGAGCACAAGTGACCACCAAGGCGGAAGTGGAGCCAG - UNI14950 - ATGTACACCTTGGGCGTCCTGATGT

CTTACCTCAGACTCCACCTTTGGAGGAAATAAGTGAGGGTTCACCTGTTCCTGGCCCCAGTTTCTCACCTGTAGTTGGACAACCTTTGCAAATACTAAAT

TTGAG - UNI10829 - TTCAACCTTGGAAAAGCTTGATGTTGCAGAGTCAGAGTTCACCCAC TGAGCAGTGAGCCTCAGAAGACCTGAAACAAGAC

TCTGCTGTCGCTTTGATCCCAAGATGTCAGCCCTTGCCCCAGGAATGCTGAATCGTCTTCTTGGTCATCAACAGAGGAGAGAATGTGGAGCTAGCAGGGC

TCTGACACTGTCTCCCCTTCCTCTGGGCAGTAGTGCCTTTGACAGTTGAGGACAGCATCGTCCCCACCACTCCAGAAGTGGGTGGCGTGAATTTTCCACT

GCCTGCCATGGCTTCTATAGCTGAATATTTTTCAAACCCCCATTCTTTGTGCTGACATGGGGTTGCTGGACTGGTGGTTTCCTCCTGTTTACCTTTCTCC

TGGAGCTGGACTCTTCATTTCCTCAGGACGGACTGGCTGGACATTGTTCCTGCCTTGGCTCTCCCGCTGGTCTTTGGAGACTCCCAATGATTTGTATAAA

GGTGTTTGGGGGAAAGTAAGGATCATCCTTACTCCCAACCTTCTTTTCCTTAAAAAAGGAAAAAAAAAAAAAAAAAAAACACAAAGAGCACACAATGTAA

ATTTGAGCCAGTCTCAGATAAAAGTTCTCTAAGTGTTGTAGAAGAGCCCTAGTGTTTGTGAAGCAGAAAGGCTGGGGCTGCCCCACCAGCAGCTGCTCTC

TGACTCCCTCACTTAGGGTTGAGGGAATAGAGAGGGCCTGGCCCTTTTTTAAGACAAAGGGGCAGCCATGTTAGGAGAGTGGACCTTAGCAGGACCCTAC

TCACTGCCAGGTCTTCGGTTATTACTATTCTGCAATTTGGAATGTATCCTCATAGTTTTTTCTAGATATAAAGAATTATCAAATGATTTTAGACCATTCT

CCAAAGGAGATTTCTTTGTTCTTCCTATATTTTCCAACAGTATTCTGCTCTTTGTGGAGCTACGGTGGAGGGAGATGTTTGTGTCTGTTTAACAGGCAGT

CTGTATCTATGAGGCTAGAGAATATTTTCTTAAACTCCTAGGGAGCCACAGACTTCCCTCTGTACGGTTGTCGCCATGTCACCTGGCCTGCCCTTACTCT

GCAGAGAAGCTGGAAATGGGGCCACGGAGCCCTCTCCTTCCTCTCAGTTGTGGCCCATCTGGTCCTGGCTGGTGGGGCAGTGCATGGTGTTTCAGGCTGG

CTGTTGAAATCCCACATTAGTTCCTTCCCTGTCCCGTCCCACCTTGATAGCAGGTTAGCCAACCCCCACGTAACTGTCTATATTAGACACCCCCAGCCAC

CTTCTGGCTGCCTGTCTTTGCTGCCATGTTCTTTTTTACAAGAAGGAAACAAACAATTTCTTGCTATTTTTTTTTCATAATTTACTATTTATGATGTATT

TAAGTGTTTTATTCAGGACAGGGTTCTGTAAGGGGTGGGAGGGAGTATTTGAGGGAGGGCTGGGACTTAGGGAAAGGACATGGGATTCAACATTTTTATG

GAGTGTTACTATTTGCCTCTACTTTGTATTGTTGAAAAATGACAGATGCAATATAAAAGTAATAAATATCTGGTTTTAAT
Translation
MASASSGPAAAGFSSLDAGAPAGTAA - UNI5111 - - UNI14772 - - UNI16381 - - UNI33559 - AAASGIKRATVSE - UNI709

4 - - UNI18295 - - UNI33559 - GPSASVMPVKKIGHRSVDSSGETTYKK - UNI8229 - TTSSALKGAIQLGITHTVGSLSTKPERDVL

MQDFYVVESIFFPS SEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYL YSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQK

LLPGYYM - UNI8058 - NLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDG

LFLDADMYSALCKTLQRDCL VLQSFKIMDYSLLMSIHNMDHAQREPTSNDTQYSADTRRPAPQKALYSTAMESIQGEARRGGTVETEDH - UNI1251

5 - HMGGIPARNNKGERLLLYIGIIDILQSYR - UNI932 - RFVKKLEHSWKALVHDG DTVSVHRPGFYAERFQRFMCNTVFKKIPL - UNI44

8 - - UNI14950 - LKPSPTKKFRSGPSFSRRSGPSGNSCTSQLMASGEHRAQVTTKAEVEPD - UNI14950 - DVHLGRPDVLPQTPPLEEIS

EGSPVPGPSFSPVVGQPLQILNLS - UNI10829 - SSTLEKLDVAESEFTH H

For any suggestions or comments, please send an email to unitrap@crg.es