Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028127 (Abcd3)
Chromosomal location
Chr 3: 121461828 - 121518114 (-)
Description
ATP-binding cassette, sub-family D (ALD), member 3 Gene [Source:MGI Symbol;Acc:MGI:1349216]
RefSeq_dna
NM_008991 
RefSeq_peptide
NP_033017.2 
UniGene
Mm.399042 
MGI
MGI:1349216 
Uniprot/SWISSPROT
P55096 
Uniprot/SPTREMBL
Q3U645 Q3UNS0 Q71V77 Q91VT3 Q9DBZ6 
Human Ortholog
ENSG00000117528 (ABCD3)
Omim 170995 - ATP-BINDING CASSETTE, SUBFAMILY D, MEMBER 3  
UniTrap UNI26159
Vector Insertion
Chr 3: 121499404 - 121517926
Public Clones IST14558G7 (tigm)
Private Clones OST133615 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26294
Vector Insertion
Chr 3: 121495821 - 121499366
Public Clones IST15014C7 (tigm) IST13355D4 (tigm) IST11481E10 (tigm)
Private Clones OST126503 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27987
Vector Insertion
Chr 3: 121494741 - 121495721
Public Clones IST12866A11 (tigm)
Private Clones OST42939 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9023
Vector Insertion
Chr 3: 121488990 - 121494651
Public Clones XF421 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029770
Sequence
AGTTTCCCCCGCGGTTCCTGCACTGAGGTTGTCGCCGGCGCGTCCCCTATCCCGCGGCTCGCTCGCCCTGCCGGTGCCATGGCGGCCTTCAGCAAGTACT

TGACGGCACGGAACACCTCGCTGGCGGGGGCCGCGTTCCTGCTGCTCTGCCTACTCCATAAGCGGCGTCGCGCCCTCGGCCTGCACGG - UNI26159 

- TAAGAAAAGTGGAAAACCGCCATTACAGAATAATGAG - UNI26294 - AAAGAAGGAAAGAAAGAGCGAGCTGTGGTGGACAAAGTGTTTTTATC

AAGGCTCTCACAGATCCTAAAAATTATGGTTCCTAGAACATTTTGTAAAGAG - UNI27987 - ACAGGCTACTTGTTACTTATTGCGGTTATGCTGG

TATCTCGAACATACTGTGATGTTTGGATGATTCAGAATGGGACGCTCATTGAGAG - UNI9023 - TGGCATCATTGGTCGCAGCAGCAAAGATTTCA

AGAGATACTTATTCAACTTCATCGCTGCCATGCCTCTT ATCTCTCTGGTTAATAACTTCTTGAAGTATGGGTTAAATGAGCTCAAACTGTGCTTCCGAG

TCAGGCTCACACGGTACCTCTACGAGGAGTATCTCCA AGCTTTCACCTATTATAAAATGGGCAACCTGGATAACAGAATAGCAAATCCAGACCAGCTGC

TTACACAGGATGTAGAAAAATTTTGTAACAGTGTAGTCGATCTGTATTCAAATCTTAGTAAG CCATTTTTAGACATAGTTTTATATATTTTCAAGTTAA

CAAGTGCAATTGGAGCTCAG GGCCCGGCAAGCATGATGGCCTACTTGCTTGTTTCTGGGCTATTCCTAACTCGACTCAGAAGACCCATTGGTAAGATGA

CAATTATGGAGCAGAAGTACGAAGGAGAATACAGATACGTGAATTCACGGCTTATCACTAATAG TGAAGAAATTGCCTTTTACAATGGGAATAAACGGG

AGAAGCAGACAATCCACTCAGTCTTCCGAAAACTG GTGGAACACCTACATAATTTCATTTTCTTTCGGTTTTCTATGGGTTTCATTGATAGCATCATTG

CCAAAT ATGTTGCCACTGTCGTCGGGTACCTGGTTGTCAGTCGCCCCTTCCTAGATCTGGCACACCCTCGCCACCTTCACAGCACACACTCAGAGCTGC

TGGAG GATTACTACCAAAGTGGAAGGATGCTTTTGAGAATGTCTCAAGCTTTGGGTCGTATAGTTTTGGCTGGGCGTGAAATGACTAGATTGGCTGG T

TTTACGGCTCGGATTACAGAATTAATGCAAGTACTAAAGGACTTAAATCATGGCAGATATGAACGTACAATGGTGTCACAACAGGAGAAGG GTATTGAA

GGAGCACAAGCTAGTCCCTTGGTCCCTGGTGCTGGAGAAATCATCAATACAGACAACATTATAAA GTTTGATCATGTTCCTTTAGCAACACCAAATGGT

GACATCTTGATCCAAGACCTTAGTTTTGAA GTTCGATCTGGGGCCAACGTTCTGATTTGTGGTCCAAACGGCTGTGGAAAGAGCTCCCTCTTCCGTGTT

CTTGGTGAG TTATGGCCTCTTTTTGGAGGGCGGCTTACTAAACCTGAGAGAGGAAAGTTATTTTATGTTCCTCAG CGACCCTATATGACCCTGGGAAC

ACTGAGAGACCAAGTCATATATCCAGATGGAAAGGAAGATCAGAAGAAGAGGGGGATCTCTGACCAG GTGCTGAAGGAGTACTTGGACAATGTGCAGCT

GGGTCACATCCTTGAGCGAGAAGGCGGCTGGGACAGTGTTCAGGACTGGATGGATGTACTCAGCGGAGGAGAGAAACAAAGAATGGCG ATGGCAAGACT

GTTTTATCATAAACCCCAGTTTGCCATTTTGGATGAATGCACAAGTGCGGTCAGTGTGGATGTGGAGGACTACATTTACAGCCACTGTCGAAAG GTTGG

CATCACCCTCTTTACCGTTTCACACAGAAAGTCCCTTTGGAAGCACCACGAG TACTACCTGCATATGGATGGGAGAGGCAATTATGAATTCAAAAAGAT

CACAGAAGATACAGTTGAGTTCGGATCATAGAGACCATCTCAAGAACTTCATTTGCTTCAAAACAAGATAATGAACAGAATGCATTTGTAAATGCAAGAT

GCATTGTAAAATAAAGTTAAGCTTGTTTTTTTTTAAAAAAAACAAAGCAACAAATTGACTAGATATAGGATAATTGAAACATGTTAAAACATTTAATATT

GTATAGGATATTGCTAATTGTGTATATGTTGGTTTAATTATTAATTATGTACTAAGAATGTCCTTATTCTTGTGGTTAAAAAACCTGCCTGAATTAAATT

GGGCTTAAATCAGTGTAACCTGATTCATCCTGGGATGTAAACCATTTGAAGTCAGCTAATTTGACTTTTATGGCTCTGTCTTTTTCTTTCATGAAGAACC

CTGTTTAAAACTGGGGTCATTAACTGTTCTATTCTAACAAAGTAGTCTTGAGTTTCATTTCTTATGCCCCATGGTAGTGGGAACCAGACCAATCACAATG

TTTTATTGAAACATATTCCATCGTTACAGGATAGCGTTCGGTACACAGTGGCGGGTTTCTTTAGCTGCTGTGTTTATTCTCATTCCTCACACATGCCTTT

AAGTGCATTGGACTCCAGGAGAGCCATTTGGGGTTTCTCTAGCTAAACAATAAATGTACCTGTCTCAGTCCGCTGGACTGAGTTGTTTTGAAGGTTCTCA

TGGTGCACAGCAGTGTGTATGTGGTGTACAACAGTGTGTATGCAGCCGTGCTTACAGCCTGTGGTTGCTACCTGTTGTACCAGTCTGACCAGTGTTTGGA

ATGTTCAGACATAATCTCCTGTGTGAAGCTCAAGGTCTTAGGAGGATTTTGGATTTTGTGAAGAGATGGACAGTCTCATCAGAAATGTGGTTGTATAATG

GTGAGCGCCACATGAGTGTAGAGGCACTATATGACGTAGTGTACTGAGCATGCAACGCTGCTGCCGTCCTTGTCTGTGGTTTCAGTTTGTAAAACTGCTA

AGCCATTCTCATGCACATGGGTGAATGACATTTCCTAGGAACGGTCTCTGACTCCTGGACAACTACTCCTGTATCGGCTCTGGCTCCCCGGAACCATTAG

AGACTAACTGTTGTTTCCACAAAGGAGGGCTGAGAGTGAACGTGATCATACGTAGTTGTGAAATCGGTTTGATTGAGTGGGCTCTGAAAGGGGCATTTAA

TGGTCTTGTTTCTTCATAACTCACAATCACTGGCTACCAAGATAACCCTGATGTATTGATTCCATAAATGCATCACATTCAGTTTTACCATGTCTCCTTA

GCAAACTTGTGTACTTATTTTCTGTTCAGATTAAAAAAAAAAAATGATAACCT
Translation
MAAFSKYLTARNTSLAGAAFLLLCLLHKRRRALGLHG - UNI26159 - GKKSGKPPLQNNE - UNI26294 - KEGKKERAVVDKVFLSRLSQIL

KIMVPRTFCKE - UNI27987 - TGYLLLIAVMLVSRTYCDVWMIQNGTLIES - UNI9023 - SGIIGRSSKDFKRYLFNFIAAMPL ISLVNNF

LKYGLNELKLCFRVRLTRYLYEEYLQ QAFTYYKMGNLDNRIANPDQLLTQDVEKFCNSVVDLYSNLSK PFLDIVLYIFKLTSAIGAQ GPASMMAYLL

VSGLFLTRLRRPIGKMTIMEQKYEGEYRYVNSRLITNS SEEIAFYNGNKREKQTIHSVFRKL VEHLHNFIFFRFSMGFIDSIIAKY YVATVVGYLVV

SRPFLDLAHPRHLHSTHSELLE DYYQSGRMLLRMSQALGRIVLAGREMTRLAG GFTARITELMQVLKDLNHGRYERTMVSQQEKG GIEGAQASPLVP

GAGEIINTDNIIK KFDHVPLATPNGDILIQDLSFE VRSGANVLICGPNGCGKSSLFRVLGE LWPLFGGRLTKPERGKLFYVPQ RPYMTLGTLRDQV

IYPDGKEDQKKRGISDQ VLKEYLDNVQLGHILEREGGWDSVQDWMDVLSGGEKQRMA MARLFYHKPQFAILDECTSAVSVDVEDYIYSHCRK VGITL

FTVSHRKSLWKHHE YYLHMDGRGNYEFKKITEDTVEFGS

For any suggestions or comments, please send an email to unitrap@crg.es