Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028134 (Ptbp2)
Chromosomal location
Chr 3: 119421918 - 119486176 (-)
Description
polypyrimidine tract binding protein 2 Gene [Source:MGI Symbol;Acc:MGI:1860489]
RefSeq_dna
NM_019550 
RefSeq_peptide
NP_062423.1 
UniGene
Mm.467907 
MGI
MGI:1860489 
Uniprot/SWISSPROT
Q91Z31 
Uniprot/SPTREMBL
Q3V328 
Human Ortholog
ENSG00000117569 (PTBP2)
Omim not available
UniTrap UNI9918
Vector Insertion
Chr 3: 119484453 - 119486119
Public Clones (sanger) NPX210 (baygenomics) NPX500 (baygenomics) 3SD058G07 (ggtc)
A039C02 (ggtc) 3SE001B09 (ggtc) IST10062F8 (tigm)
Private Clones OST211322 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2934
Vector Insertion
Chr 3: 119464697 - 119484421
Public Clones AD0210 (sanger) (sanger) AD0212 (sanger) RRU584 (baygenomics) DTM017 (baygenomics)
Private Clones OST469201 (lexicon) OST418618 (lexicon) OST328726 (lexicon) OST316221 (lexicon)
OST184554 (lexicon) OST182576 (lexicon) OST168312 (lexicon) OST134490 (lexicon)
OST88786 (lexicon) OST53066 (lexicon) OST52641 (lexicon) OST38676 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5621
Vector Insertion
Chr 3: 119456035 - 119464620
Public Clones YHB091 (baygenomics) XE422 (baygenomics) CSI803 (baygenomics) XE704 (baygenomics)
A068D07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029780
Sequence
CTGGCTGCGTGGCTCGGTTCTTGGGAGCGAAGCTTTGTCCGGTTCGGCAATGGACGG - UNI9918 - AATTGTCACTGAGGTTGCTGTTGGTGTGAA

G - UNI2934 - AGAGGATCTGACGAGCTACTCTCAGGCAGTGTTCTCAGCAGCCCCAACTCTAATATGAGTGGCATGGTAGTTACAG - UNI5621

 - CCAACGGTAACGATAGTAAGAAATTTAAAGGAGAAGATAAAATGGATGGGGCTCCCTCTCGTGTACTTCACATTCGAAAGTTACCTGGTGAAGTGAC

TGAAACAGAAGTTATTGCTTTAGGTTTACCTTTTGGTAAGGTGACTAACATCCTTATGCTGAAAGGAAAAAACCAG GCATTTTTGGAACTGGCAACAGA

GGAAGCAGCTATTACTATGGTTAATTACTATTCTGCTGTGACACCTCATCTTCGTAACCAACCAATTTACATCCAGTACTCCAATCACAAAGAACTAAAG

ACAGATAATACATTAAACCAA CGTGCGCAAGTAGTTCTTCAAGCTGTGACAGCGGTCCAGACAGCAAATACACCTCTTAGTGGCACCACAGTCAGTGAG

AGTGCGGTGACTCCAGCCCAGAGTCCAGTACTTAGAATAATTATTGACAATATGTACTACCCTGTAACACTTGATGTCCTTCACCAA ATATTTTCTAAG

TTTGGTGCTGTATTGAAGATAATCACATTTACAAAAAACAACCAGTTTCAGGCTTTGCTCCAGTATGGTGATCCGGTAAACGCTCAACAAGCCAAGCTA 

GCCCTAGATGGTCAAAATATTTATAATGCTTGCTGTACCCTAAGGATTGATTTTTCCAAACTTGTGAATTTGAATGTAAAATACAACAATGATAAAAGTA

GGGATTATACTCGACCTGATCTGCCATCTGGAGACGGCCAGCCTGCGTTAGACCCAGCCATTGCTGCAGCATTTGCCAAGGAGACATCCCTACTAG CTG

TTCCAGGGGCTCTCAGTCCTTTGGCTATTCCAAATGCTGCTGCAGCAGCTGCTGCCGCTGCCGCTGGCCGAGTGGGCATGCCTGGAGTCTCAGCTGGTGG

CAATACAGTCCTGTTGGTTAGCAATTTAAATGAAGAG ATGGTTACGCCCCAAAGTCTGTTTACCCTCTTCG GTGTTTATGGAGATGTGCAGCGCGTGA

AGATTCTGTACAATAAGAAAGACAGTGCTCTGATACAGATGGCTGATGGGAACCAGTCCCAGCTCG CCATGAATCATCTTAATGGGCAGAAGATGTATG

GAAAAATTATTCGTGTTACTCTCTCTAAACATCAGACTGTGCAACTACCTCGAGAGGGACTTGATGATCAAGGGCTAACAAAAGATTTTGGGAATTCACC

ACTGCACCGTTTTAAAAAACCGGGATCCAAAAACTTTCAGAACATTTTCCCTCCTTCTGCTACCCTTCACCTGTCTAACATCCC CCCTTCTGTAGCAGA

AGAGGATCTGCGAACTCTGTTTGCCAACACCGGGGGCACTGTGAAAGCATTTAAGTTTTTTCA AAGAGATCACAAAATGGCTCTTCTTCAGATGGCAAC

AGTGGAGGAAGCTATTCAGGCTTTGATTGATCTTCATAATTATAACCTTGGAGAAAACCATCATCTGAGAGTGTCTTTCTCCAAGTCAACAATCTAAGCA

CGGGAGATGAAGATGGCGGGCAGATCCCATTGTTGGTGTCATCACCTATTGACTGTTCAGAAAAGTGGGGACCAGAGTTTGATTTTTTTCATGCTGTTAT

CATTCCTTGGTTATAAAATGAAATGGCATATGTAAAGGCAGAGTTGCTAACTGCTGTGTTTCATCTGTTCAATAGGGAAGCCATTTTTGTCTGTTTAAAT

TTTTAGTTTAATTTTGCTTTTTTTTTTTTTTCCAACTTAGTTGACATACGTGCCTTACAAAGGAAAACTAGTGTTGCTATTCTGCATTTACTAGGAAAAA

GGAATTGGTTGTTTAGGGCACATCGTTATGTGGGAATTAAAATATGTTTGGGCAGGGGTGTGTCAAAAGGTTAAGTTTTTATTTCTCCTGCTTGGAACTT

TCTTTGAATTATTGGCTTATCACATTTCTTTCTATTTAATCTAATAAGATACTTGATACTGAGAGTATAAAACAGCATTTTTAGTTTTTACTATCTTAGG

CTTTATTGCTTTTGAAAACATTGGCCTTTTGTATCTCACAAATCTGGTCTAGATTCAGTTATGAATGTAGGCATTAGTTAAAATTAACAAGATGCAGAGT

ATTAATTTCTTAAGACAAGTGATTTCTGTAAGTTTGAGCCCTATGTGGAAAGCATTGTGGAACCTTAACCTTTTTGTACACACTCTTGTGGGACGTGTCA

TATAAATGTCAGCACTAAGTAATGTCTTGTTTGTGGCTGAATATTTTTCGTAGATGTTTTTGAAGTTGACATGACTTACGTGCATTTAAATATATATTGC

CATCCTTAGTTTGTAATTAAGATTTGGAAAATGGTTGTGGATTTCTGAGCATGTGCAGACTGGTCTAGCTAGTTCAGGAACTGGTGCATGTATTTTTCAA

AGACAAAGAAAGTGTACTGCGAAAACTTGCAGGAAGATTAATTTTGTGGCAGTTTTCTAAAACTGACAACCAGGTGGGACCAAAGTTTATGTGCCTTTAG

TCTTAATTTACCTTGCATTGTAATATTCAGTTTTAATAAATCTTCAAAATATTTTGTATTTAGGAATAGATCTGACTTTAATAAAAACATGGCTCAGAAT

CTACAGGTCAAATTTATTTGAACAGTTCTTGTCAATCTGAATTGTTGATTCTGTTAAATGACCAATACTTTTTGAAATTGATGTACTTAGTTTCAAGATT

CATAGATTCTGTTATCTATGTAGACAGAATGGTCATGTATATTTTCTATTAGTTGAGTTTTTACATCTTTAGAAATGTAAAATTCAGTATAGTTTGAAAG

CGGCACAATTAAAAATTAATTTTCT
Translation
MDG - UNI9918 - GIVTEVAVGVK - UNI2934 - RGSDELLSGSVLSSPNSNMSGMVVTA - UNI5621 - ANGNDSKKFKGEDKMDGAPSR

VLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQ AFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQ RAQVVLQAVTAVQ

TANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQ IFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKL ALDGQNIYNACCTLRIDFS

KLVNLNVKYNNDKSRDYTRPDLPSGDGQPALDPAIAAAFAKETSLLA AVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEE MVTP

QSLFTLFG GVYGDVQRVKILYNKKDSALIQMADGNQSQLA AMNHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQ

NIFPPSATLHLSNIP PPSVAEEDLRTLFANTGGTVKAFKFFQ QRDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI

For any suggestions or comments, please send an email to unitrap@crg.es