Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028152 (Tspan5)
Chromosomal location
Chr 3: 138405159 - 138567388 (+)
Description
tetraspanin 5 Gene [Source:MGI (curated);Acc:Tspan5-001]
RefSeq_dna
NM_019571 
RefSeq_peptide
NP_062517.1 
UniGene
Mm.411435 Mm.408192 Mm.31927 Mm.409286 Mm.416020 
MGI
MGI:1928096 
Uniprot/SWISSPROT
P62080 
Uniprot/SPTREMBL
Q9CYT0 
Human Ortholog
ENSG00000168785 (TSPAN5)
Omim not available
UniTrap UNI2145
Vector Insertion
Chr 3: 138405625 - 138472837
Public Clones (sanger) AA0239 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22050
Vector Insertion
Chr 3: 138523632 - 138531309
Public Clones not available
Private Clones OST310333 (lexicon) OST271449 (lexicon) OST250571 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29410
Vector Insertion
Chr 3: 138561348 - 138565342
Public Clones CMHD-GT_441H2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121826
Sequence
AGAACGTTAGTCCGCTGTTGGTGAGGCTGTTGGTGAGGCTCGGCTTCCTGCAGTGCTGGTCGGGAACTTTGTTTCAGTCTGGACAGATCGCAGGTGAAAT

TGCTACATCTTAAGCAAACAGGAGTAAGGAGTGCTCGTTTAGAAGCCGCTTAAGAACTTGGATGGCTGGGCCCTG - UNI22050 - TTTTTGGGAAT

AACGTTTCTTGGAATCGGACTGTGGGCGTGGAATGAAAAA GGTGTCCTCTCCAACATCTCGTCCATCACCGACCTCGGTGGCTTTGACCCAGTGTGGCT

TTTCCTTGTGGTGGGAGGAGTGATGTTCATTCTGGGGTTTGCAGGGTGCATCGGAGCACTTCGGGAAAACACCTTTCTTCTCAAGTTT TTTTCTGTGTT

CCTGGGGATTATTTTCTTCCTGGAACTCACTGCTGGGGTGTTGGCATTTGTTTTCAAAGACTGGATCAAAGACCAGCTGTATTTCTTTATTAACAACAAC

ATCAGAGCCTACAGAGATGACATTGATCTACAGAACCTCATAGACTTCACCCAGGAATAT TGGCAGTGCTGTGGGGCTTTTGGAGCTGATGATTGGAAC

CTAAATATTTACTTCAATTGCACAGATTCCAATGCAAGCCGAGAGCGATGCGGTGTGCCATTTTCCTGCTGCACTAAAGACCCCGCG GAAGATGTCATC

AACACTCAGTGTGGCTATGATGCCAGGCAGAAACCA GAAGTTGACCAACAGATTGTAATCTACACAAAAGGCTGTGTGCCCCAGTTTGAGAAGTGGCTA

CAGGACAATTTAACCATCGTGGCTGGTATTTTCATAGGCATTGCATTGCTACAG - UNI29410 - ATTTTTGGGATATGCCTGGCACAGAATTTGGT

GAGTGACATTGAAGCTGTCAGGGCTAGCTGGTAGACCCCTGCGACCACTGCTGTCAGACACTGGACTGATCCCCCCTCACTGACTGACCCTCTGTGCGCC

GGCCGGCTGATGGCGGGCTGTAGAGGCCTGGTCACAGGCCTACAGTCTCACCTGATGGAGCTGCCAAGAACTTAACTTTCTGTGGGGGTAGAACTGGGAA

ATGCTGCTCACAGACGGAACTTGGAAAAAGAAAAACAAAACAAGTGC
Translation
 - UNI22050 -  MFILGFAGCIGALRENTFLLKF FSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEY WQCC

GAFGADDWNLNIYFNCTDSNASRERCGVPFSCCTKDPA EDVINTQCGYDARQKP EVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIFIGIALLQ - UN

I29410 - IFGICLAQNLVSDIEAVRASW
Transcript ENSMUST00000119993
Sequence
AAGTGAGAAGCTGCCATTGCCACCTGCCTGAAGCTTCCAGCCGGCATATGGAGGGTCCCAGCCGGCATATGGAGGGTCCGTGCACTTCTTCAGGAAGCAT

CAGACCTTTGGCTCAGCAGAAGGGATTCCTGAGCAGGTGTCTGGGTGGGAG - UNI22050 - TTTTTGGGAATAACGTTTCTTGGAATCGGACTGTG

GGCGTGGAATGAAAAA GGTGTCCTCTCCAACATCTCGTCCATCACCGACCTCGGTGGCTTTGACCCAGTGTGGCTTTTCCTTGTGGTGGGAGGAGTGAT

GTTCATTCTGGGGTTTGCAGGGTGCATCGGAGCACTTCGGGAAAACACCTTTCTTCTCAAGTTT TTTTCTGTGTTCCTGGGGATTATTTTCTTCCTGGA

ACTCACTGCTGGGGTGTTGGCATTTGTTTTCAAAGACTGGATCAAAGACCAGCTGTATTTCTTTATTAACAACAACATCAGAGCCTACAGAGATGACATT

GATCTACAGAACCTCATAGACTTCACCCAGGAATAT TGGCAGTGCTGTGGGGCTTTTGGAGCTGATGATTGGAACCTAAATATTTACTTCAATTGCACA

GATTCCAATGCAAGCCGAGAGCGATGCGGTGTGCCATTTTCCTGCTGCACTAAAGACCCCGCG GAAGATGTCATCAACACTCAGTGTGGCTATGATGCC

AGGCAGAAACCA GAAGTTGACCAACAGATTGTAATCTACACAAAAGGCTGTGTGCCCCAGTTTGAGAAGTGGCTACAGGACAATTTAACCATCGTGGCT

GGTATTTTCATAGGCATTGCATTGCTACAG - UNI29410 - ATTTTTGGGATATGCCTGGCACAGAATTTGGTGAGTGACATTGAAGCTGTCAGGGC

TAGCTGGTAGACCCCTGCGACCACTGCTGTCAGACACTGGACTGATCCCCCCTCACTGACTGACCCTCTGTGCGCCGGCCGGCTGATGGCGGGCTGTAGA

GGCCTGGTCACAGGCCTACAGTCTCACCTGATGGAGCTGCCAAGAACTTAACTTTCTGTGGGGGTAGAACTGGGAAATGCTGCTCACAGACGGAACTTGG

AAAAAGAAAAACAAAACAAGTGCGCAACTTGCTGAGTCAACGTGCAGTGAATCTCTACTGTAGCCGTGGATTGGTGGTCGGATGGATGCTACCAGAAGGG

GGAAGGGGGGAGGTTGGGCACGGCATGTACTTGAATTTTTGGAGAATACAGTGCTGTACACATCTTGGCTAAAACTTGGGCCCTTAGCCGTCAGGGCCAG

GTGTCTTGAAATCTCTCAAACCCTTTGCATCTGTCCTCCAGAGAAGAAACCAGCTGCCCCCTGTGTTCAGATTCTGAGAGAGGTGGAGCGGGTCACGATA

CAGCATGCGCCCTTCATCCTGAGTTTGCCCTTAAGAGAACTGGGCGTTTGCAGTAAACTAGGGTGCCAGAGGCTGAGCTCCACATTTCCACAGGACTGCT

CTTTCCTCTGAGTGGCCAGCCCGAGCCTGAGCTCTGTCAATGACATCCAAGGAGAAAATGAGGTTAATGAGAGACATTAATTAAACACTCCCTCACCCCA

CCGCACCAAACCAGTTGGGTTCTTCTGATATTCTGGAATACTCTGGGCTATGTTTTATGTTTTATTTCTTTTTTAATCGGTTGTTATTTTGGTTCTTTTT

TTTTTTCTTTCTTTCTTTTTTCTTTTTGTCTCCCAAAGGAGGCTATGACACAGTTCTCTTGGTTTCTTATTCAGCTTGAATAGTAAGTTTTTGTAGACTT

GTCACCTGCATGTACTGTAACCCCACCCCCACCCCCAAATCCACCATGTTCTTTTCAGAGAGACATTTGAGCGTGTTCCTTAGTGTTTATGTCCTAGGTA

TCCAGCCTTGAGTGGTTGTGGAGTGTTGTCCTAGCCGCATCTTTGTATGCCCCTCAGGCTCTCTGTCTCTCCTGGCATCCAATTCAGCTTCTGTCCATTC

GCCATTGAGTGGTAGAAAAGCCCAGCTCCAAAGCAGGGTTGACACAGTCAAAAAGCATTTCATGAGGTTTTTCTTTCTTTTCTTTTTCCTCCCTTTTTGC

AACTTTAGTTTTGTCGTATATTAAATAAAAAACCAAGCCT
Translation
 - UNI22050 -  MFILGFAGCIGALRENTFLLKF FSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEY WQCC

GAFGADDWNLNIYFNCTDSNASRERCGVPFSCCTKDPA EDVINTQCGYDARQKP EVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIFIGIALLQ - UN

I29410 - IFGICLAQNLVSDIEAVRASW
Transcript ENSMUST00000029800
Sequence
GCGGAGCTGCGGGCCGGGGCGGGCGGAGCGAGCGGCGGGAGGAGCGAGCGGTGGGAGGCGCGCGAGCGGGCGGCGGGCAGCGTCTCCGCCGGCATCTGCG

CGGCCGCCTCTGCCCGGAGCCCGGGGACCGAGCGCCGGACCCGCCGCCTGGCGCACCGACGCGGAGCTCCCGCTTTGTGCTCCGTGCCGGTTCGAGGAGG

CTTCCCGGAGGCTGCGGCCACCGCGCCCCGGCGGCCTCGGAGGCCCGCGGCTGGAGGTGCCGGAGCTGCTCGGTCCGCGCGGCTGAGCCCCGCGTGCCCC

ACTGCTCGCCGGGCTGCTCCGAGCCGGGGTGCTCCGGGGCTCCAAACTCGGGCTGGCGGGGCAAGTGTCTTCATGAACCCAGAGGATGTCCGGGAAGCAC

TACAAGGGTCCTGAAGTCAGTTGTTGCATCAAATACTTCATTTTTGGCTTCAATGTCATATTTTGG - UNI2145 - - UNI22050 - TTTTTGGG

AATAACGTTTCTTGGAATCGGACTGTGGGCGTGGAATGAAAAA GGTGTCCTCTCCAACATCTCGTCCATCACCGACCTCGGTGGCTTTGACCCAGTGTG

GCTTTTCCTTGTGGTGGGAGGAGTGATGTTCATTCTGGGGTTTGCAGGGTGCATCGGAGCACTTCGGGAAAACACCTTTCTTCTCAAGTTT TTTTCTGT

GTTCCTGGGGATTATTTTCTTCCTGGAACTCACTGCTGGGGTGTTGGCATTTGTTTTCAAAGACTGGATCAAAGACCAGCTGTATTTCTTTATTAACAAC

AACATCAGAGCCTACAGAGATGACATTGATCTACAGAACCTCATAGACTTCACCCAGGAATAT TGGCAGTGCTGTGGGGCTTTTGGAGCTGATGATTGG

AACCTAAATATTTACTTCAATTGCACAGATTCCAATGCAAGCCGAGAGCGATGCGGTGTGCCATTTTCCTGCTGCACTAAAGACCCCGCG GAAGATGTC

ATCAACACTCAGTGTGGCTATGATGCCAGGCAGAAACCA GAAGTTGACCAACAGATTGTAATCTACACAAAAGGCTGTGTGCCCCAGTTTGAGAAGTGG

CTACAGGACAATTTAACCATCGTGGCTGGTATTTTCATAGGCATTGCATTGCTACAG - UNI29410 - ATTTTTGGGATATGCCTGGCACAGAATTT

GGTGAGTGACATTGAAGCTGTCAGGGCTAGCTGGTAGACCCCTGCGACCACTGCTGTCAGACACTGGACTGATCCCCCCTCACTGACTGACCCTCTGTGC

GCCGGCCGGCTGATGGCGGGCTGTAGAGGCCTGGTCACAGGCCTACAGTCTCACCTGATGGAGCTGCCAAGAACTTAACTTTCTGTGGGGGTAGAACTGG

GAAATGCTGCTCACAGACGGAACTTGGAAAAAGAAAAACAAAACAAGTGCGCAACTTGCTGAGTCAACGTGCAGTGAATCTCTACTGTAGCCGTGGATTG

GTGGTCGGATGGATGCTACCAGAAGGGGGAAGGGGGGAGGTTGGGCACGGCATGTACTTGAATTTTTGGAGAATACAGTGCTGTACACATCTTGGCTAAA

ACTTGGGCCCTTAGCCGTCAGGGCCAGGTGTCTTGAAATCTCTCAAACCCTTTGCATCTGTCCTCCAGAGAAGAAACCAGCTGCCCCCTGTGTTCAGATT

CTGAGAGAGGTGGAGCGGGTCACGATACAGCATGCGCCCTTCATCCTGAGTTTGCCCTTAAGAGAACTGGGCGTTTGCAGTAAACTAGGGTGCCAGAGGC

TGAGCTCCACATTTCCACAGGACTGCTCTTTCCTCTGAGTGGCCAGCCCGAGCCTGAGCTCTGTCAATGACATCCAAGGAGAAAATGAGGTTAATGAGAG

ACATTAATTAAACACTCCCTCACCCCACCGCACCAAACCAGTTGGGTTCTTCTGATATTCTGGAATACTCTGGGCTATGTTTTATGTTTTATTTCTTTTT

TAATCGGTTGTTATTTTGGTTCTTTTTTTTTTTCTTTCTTTCTTTTTTCTTTTTGTCTCCCAAAGGAGGCTATGACACAGTTCTCTTGGTTTCTTATTCA

GCTTGAATAGTAAGTTTTTGTAGACTTGTCACCTGCATGTACTGTAACCCCACCCCCACCCCCAAATCCACCATGTTCTTTTCAGAGAGACATTTGAGCG

TGTTCCTTAGTGTTTATGTCCTAGGTATCCAGCCTTGAGTGGTTGTGGAGTGTTGTCCTAGCCGCATCTTTGTATGCCCCTCAGGCTCTCTGTCTCTCCT

GGCATCCAATTCAGCTTCTGTCCATTCGCCATTGAGTGGTAGAAAAGCCCAGCTCCAAAGCAGGGTTGACACAGTCAAAAAGCATTTCATGAGGTTTTTC

TTTCTTTTCTTTTTCCTCCCTTTTTGCAACTTTAGTTTTGTCGTATATTAAATAAAAAACCAAGCCTAGTATAGTGCATGTGCTCGCTGAGGTGACCTCG

GGGTGGTTACAAAGCACAAATATTTGAGGGGCTGCGCCGAAGCCCAGCCAGGGTTCAGTGACGCTAGGTGGAAAACCACCTTCAGGTTCTTCTCCTGCCT

CGTGCCCACTGGGAGGGTGGACTTTAGCCCCAGATCCCCCCACCCCCAGCTTGTGATAACCCCTGGATGTTGCTTTCACGGGGAGCAGATTTAGTTTGTG

GGTTTGCTGGGAAGGCCCCAGCCTCTGCGAAAAGCAGCTCCCCATTGGCCAGCCAGCAGTCTGCGTCATGCAGCCCGGTTTTCCATTTCCGCAGCACGTG

TGCGTTGCCGTGGCTGATGGGCGCTGTCTGCTCAGAGGGAGGTCAGGCACTCCTTGGGTTTACGTGGCTCTGCATGTTTGTATCGGTGTCTGTTTTTAGG

TAGAGATAGTCATTCCATACGTGGATGCGAGGTCACGTGACTTCACCCCTGTCCATACCACAGCCGTCGCTTGTGATGTCCTTCAACATGGACACTCGTG

CTCTCGGATTGGCACTTCTGTCTTCTTTATTACCTCATTCTCCAGTGAACTGCATCTGGCCAATTGATTCAGAATCAGACAGGATCCCCACCCCGTGGCA

CATCCAGTGAAAGCCAAAACACAAGCCCAAGCGAGTTTTAAATTTTAATCACCCTTTATTTTTTACACTCGAGAGTGATTGTAATAAAAGCTGTCATTAA

TAAACTCGGTTCTACCT
Translation
MSGKHYKGPEVSCCIKYFIFGFNVIFW - UNI2145 - - UNI22050 - FLGITFLGIGLWAWNEK GVLSNISSITDLGGFDPVWLFLVVGGVMF

ILGFAGCIGALRENTFLLKF FSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEY WQCCGAFGADDWNLNIYFNCT

DSNASRERCGVPFSCCTKDPA EDVINTQCGYDARQKP EVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIFIGIALLQ - UNI29410 - IFGICLAQ

NLVSDIEAVRASW

For any suggestions or comments, please send an email to unitrap@crg.es