Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028159 (Dapp1)
Chromosomal location
Chr 3: 137595652 - 137644481 (-)
Description
dual adaptor for phosphotyrosine and 3-phosphoinositides 1 Gene [Source:MGI (curated);Acc:Dapp1-001]
RefSeq_dna
NM_011932 
RefSeq_peptide
NP_036062.1 
UniGene
Mm.254835 
MGI
MGI:1347063 
Uniprot/SWISSPROT
Q9QXT1 
Uniprot/SPTREMBL
Q3TEK6 Q3UK44 Q3UL29 
Human Ortholog
ENSG00000070190 (DAPP1)
Omim not available
UniTrap UNI21829
Vector Insertion
Chr 3: 137628968 - 137644282
Public Clones (ggtc) IST10768D12 (tigm) IST10691C3 (tigm) IST12478A11 (tigm) IST13631G12 (tigm)
IST12026D1 (tigm)
Private Clones OST316371 (lexicon) OST199760 (lexicon) OST165903 (lexicon) OST141243 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24489
Vector Insertion
Chr 3: 137624540 - 137628844
Public Clones not available
Private Clones OST218176 (lexicon) OST166699 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27013
Vector Insertion
Chr 3: 137612742 - 137624405
Public Clones CMHD-GT_510C5-3 (cmhd)
Private Clones OST78808 (lexicon) OST68234 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1448
Vector Insertion
Chr 3: 137603873 - 137612610
Public Clones CG0110 (sanger) CMHD-GT_465G12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098582
Sequence
CTTAGCGAGGAGGAGCAGCGCGTCCAGCAGCAGCCGATCCCATCTCTCTCTTCATACAGCACCTGGCGGGGAGTCAGCCATCAGAAGCAAAGGAACTTAT

GGGCAGAGCAGAACTTCTAGGAGGGAACATGAGTACCCAGGATCCCTCAGAGCTGTGGGGCAGAGCAGATGGAGGCACAGACCTGCTCCAGGATTTGGG 

- UNI21829 - - UNI24489 - AGCCAAAGACTCTGTCAAACACTTTCATGTTGAATATACTGGGTACTCGTTTAAATTCGGCTTTAATGAGTATT

CATCTCTAAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAG - UNI27013 - GGACTCTGATGGTTTTGAAGCATCCC

TATCCAAGGGAAGTGGAAGAACCTTGCATTTACGAATCAGTCCGGGTTCACACAGCGATGCAGACAGGAAGGACAGAGAACGACCTCGTGCCCACTGCGC

CTTCT - UNI1448 - CTGGGCACCAAAGAAGGCTATCTCACCAAGCAGGGAGGCCTGGTAAAG ACCTGGAAAACAAGATGGTTTACTTTGCAAAGG

AACGAACTGAAATATTTCAAAGACCAGATG TCACCAGAACCAATTCGGATCCTAGACCTAACAGAGTGCTCAGCTGTTCAATTTGATTACTCACAGGAA

CGAGTAAACTGTTTCTG CCTAGTGTTTCCATTCAGGACATTTTATCTCTGTGCAAAGACGGGAGTTGAAGCCGATGAATGGATCAAAATACTGAGATGG

AAGTTG TCAAAAATAAGAAAACAGCTGGATCAAGGAGAAGATACCGTCCGATCTAGGTCATTTATCTTCAAATAGACTTGTGTGCTCAGGGGCACGGTT

GACTGTTCCAGGTGTCTGATCTGTGGCAGACTTCAGAGGAAAACTCATTGAAGTATTTCCTCTAAAAACAAATCAAAAGTAGATCGTGGTTGGGAGCTGT

CTGCTGTCTGCTGATCCATGGAAAACAGCTGGCAGGACCTGGCCATCTGCTCGAGAACAGAAGCAGCGCCCTGCTGATGGCAACTGCCTAGCGTCCAGGT

GGAGCCACTCTCAGACACAGCGCCAGACAAGAGCTCATTGGCTGTCCCAGTGGCTCAGGCTCATTGACTTTAGTTTCCTGGAGTTCAGCCCCAAGTCATG

GTCAGCACAACTAAACTTCAGGACTTGCTACAAGCACAAGGAAACAGCAGTGCATCAGGGAGCTCGGGCTGGGCTTTAGGAAGCAGATTAATAAACACCA

AGGACATTC
Translation
MGRAELLGGNMSTQDPSELWGRADGGTDLLQDLG - UNI21829 - - UNI24489 - GAKDSVKHFHVEYTGYSFKFGFNEYSSLKDFVKHFANQP

LIGSETG - UNI27013 - GTLMVLKHPYPREVEEPCIYESVRVHTAMQTGRTENDLVPTAPS - UNI1448 - LGTKEGYLTKQGGLVK TWKTR

WFTLQRNELKYFKDQM SPEPIRILDLTECSAVQFDYSQERVNCFC CLVFPFRTFYLCAKTGVEADEWIKILRWKL SKIRKQLDQGEDTVRSRSFIFK

Transcript ENSMUST00000029806
Sequence
CTTAGCGAGGAGGAGCAGCGCGTCCAGCAGCAGCCGATCCCATCTCTCTCTTCATACAGCACCTGGCGGGGAGTCAGCCATCAGAAGCAAAGGAACTTAT

GGGCAGAGCAGAACTTCTAGGAGGGAACATGAGTACCCAGGATCCCTCAGAGCTGTGGGGCAGAGCAGATGGAGGCACAGACCTGCTCCAGGATTTGGG 

- UNI21829 - GTGGTATCACGGCAACCTCACCCGCCATGCTGCCGAAGCCCTTCTGCTCTCCAATGGACGTGATGGTAGCTACCTGCTGCGGGACAG

CAATGAGCAGACTGGGCTCTACTCTCTCTCTGTGAG - UNI24489 - AGCCAAAGACTCTGTCAAACACTTTCATGTTGAATATACTGGGTACTCGT

TTAAATTCGGCTTTAATGAGTATTCATCTCTAAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAG - UNI27013 - GG

ACTCTGATGGTTTTGAAGCATCCCTATCCAAGGGAAGTGGAAGAACCTTGCATTTACGAATCAGTCCGGGTTCACACAGCGATGCAGACAGGAAGGACAG

AGAACGACCTCGTGCCCACTGCGCCTTCT - UNI1448 - CTGGGCACCAAAGAAGGCTATCTCACCAAGCAGGGAGGCCTGGTAAAG ACCTGGAAA

ACAAGATGGTTTACTTTGCAAAGGAACGAACTGAAATATTTCAAAGACCAGATG TCACCAGAACCAATTCGGATCCTAGACCTAACAGAGTGCTCAGCT

GTTCAATTTGATTACTCACAGGAACGAGTAAACTGTTTCTG CCTAGTGTTTCCATTCAGGACATTTTATCTCTGTGCAAAGACGGGAGTTGAAGCCGAT

GAATGGATCAAAATACTGAGATGGAAGTTG TCAAAAATAAGAAAACAGCTGGATCAAGGAGAAGATACCGTCCGATCTAGGTCATTTATCTTCAAATAG

ACTTGTGTGCTCAGGGGCACGGTTGACTGTTCCAGGTGTCTGATCTGTGGCAGACTTCAGAGGAAAACTCATTGAAGTATTTCCTCTAAAAACAAATCAA

AAGTAGATCGTGGTTGGGAGCTGTCTGCTGTCTGCTGATCCATGGAAAACAGCTGGCAGGACCTGGCCATCTGCTCGAGAACAGAAGCAGCGCCCTGCTG

ATGGCAACTGCCTAGCGTCCAGGTGGAGCCACTCTCAGACACAGCGCCAGACAAGAGCTCATTGGCTGTCCCAGTGGCTCAGGCTCATTGACTTTAGTTT

CCTGGAGTTCAGCCCCAAGTCATGGTCAGCACAACTAAACTTCAGGACTTGCTACAAGCACAAGGAAACAGCAGTGCATCAGGGAGCTCGGGCTGGGCTT

TAGGAAGCAGATTAATAAACACCAAGGACATTC
Translation
MGRAELLGGNMSTQDPSELWGRADGGTDLLQDLG - UNI21829 - GWYHGNLTRHAAEALLLSNGRDGSYLLRDSNEQTGLYSLSVR - UNI2448

9 - RAKDSVKHFHVEYTGYSFKFGFNEYSSLKDFVKHFANQPLIGSETG - UNI27013 - GTLMVLKHPYPREVEEPCIYESVRVHTAMQTGRTEN

DLVPTAPS - UNI1448 - LGTKEGYLTKQGGLVK TWKTRWFTLQRNELKYFKDQM SPEPIRILDLTECSAVQFDYSQERVNCFC CLVFPFRTFY

LCAKTGVEADEWIKILRWKL SKIRKQLDQGEDTVRSRSFIFK

For any suggestions or comments, please send an email to unitrap@crg.es