Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028165 (Cisd2)
Chromosomal location
Chr 3: 135069378 - 135086889 (-)
Description
CDGSH iron sulfur domain 2 Gene [Source:MGI (curated);Acc:Cisd2-001]
RefSeq_dna
NM_025902 
RefSeq_peptide
NP_080178.1 
MGI
MGI:1914256 
Uniprot/SWISSPROT
Q9CQB5 
Human Ortholog
ENSG00000145354 (CISD2)
Omim 604928 - WOLFRAM SYNDROME 2  
UniTrap UNI16684
Vector Insertion
Chr 3: 135074190 - 135086222
Public Clones (sanger) 3SE064D11 (ggtc) 3SD142G05 (ggtc) 5SE064D11 (ggtc) CMHD-GT_536G6-3 (cmhd)
IST11336A8 (tigm) IST11896G3 (tigm) IST10156H10 (tigm) IST14654B2 (tigm)
IST12917B3 (tigm) IST14515H11 (tigm) IST10166A6 (tigm) IST10916E5 (tigm)
IST10423A5 (tigm)
Private Clones OST455925 (lexicon) OST438453 (lexicon) OST377458 (lexicon) OST262888 (lexicon)
OST254639 (lexicon) OST236508 (lexicon) OST100387 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16936
Vector Insertion
Chr 3: 135073974 - 135074190
Public Clones not available
Private Clones OST452154 (lexicon) OST432333 (lexicon) OST422789 (lexicon) OST358849 (lexicon)
OST355716 (lexicon) OST329819 (lexicon) OST238473 (lexicon) OST204385 (lexicon)
OST74580 (lexicon) OST68121 (lexicon) OST64091 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2547
Vector Insertion
Chr 3: 135071855 - 135072975
Public Clones XS0445 (sanger) CMHD-GT_414C6-3 (cmhd) IST12334F3 (tigm)
Private Clones OST453598 (lexicon) OST394766 (lexicon) OST303714 (lexicon) OST251983 (lexicon)
OST203966 (lexicon) OST65310 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120988
Sequence
CTCACGCAAGCGCAGCAGCCGGGCAGCGGACGCCGCCGGCGGCAGGATGGTCCTGGACAGCGTGGCCCGCATCGTGAAGGTGCAGCTGCCCGCCTACCTC

AAGCAGCTCCCGGTCCCCGACAGCATCACCGGGTTCGCCCGCCTCACAG - UNI16684 - - UNI16936 - TTTCAGACTGGCTCCGCCTACTGC

CCTTCCTCGGGGTACTTGCGCTTCTGGGCTACCTCGCAGTGCGCCCATTCTTCCCAAAGAAGAAGCAACAGAAGGATAGCTTGATCAATCTTAAGATACA

AAAGGAAAATCCCAAGGTGGTGAATGAGATAAACATTGAAGATCTGTGTCTCACCAAAGCAGCTTATTGTAGGTGCTGGCGGTCCAAGACGGTAAGATAG

CCATTTATACATAGGGTAAGACTGTGCGGTTACGATGGCCCTTCATACGGTAAGACATAGGGTAAGACTGTGCGGTTACGATGCTCCTTCAGTCCTCGGT

TTTGAAATTCTGTGAGATTAGGAATTTCTCCATACTGTTTAATATTCAGAGCCGATAGTCCCAAATTGAGGTTTGCCCTTTTTTGCTTGATCGTGCCTGT

AGTAGAGAGCAGAGAGCAGCGGACTCTGCTACGCTCCCGCTGTTCAGCGTCTGTCTAGAGCAGTGTTTTTTAGTGTTCCGGGATGAGGGGGGATTTAAGA

ATTTAAGATTTAATGAAAAGGAGTCTAAACCTTGATGTCTAAATAATTACTTAAATTTGATGTCAGTCTGTCACTTGGCAGGTTAAGCCAATTGCCAACT

TGATTTTGATTGGGCCCCTCCCCTCTCCTTCTCCCTCCTTCCTCCCTTTCTCACACATACCAGGGTCTCATGTCCCACCCTAAATGGCCTAGAATTGGTG

GTATTTACCAGGCAACGCTGGAACTCGGAGAAACTTAGGGCTCTTCCCCTGAGTGTTGGTGTGAAAGGTGTGGAGCCAGTTTGCCTCCCCTGAGTTACTT

AACTTTTAATCTCTGGCTATGGGGTGTGGTTGTTGTTGTTGTGTGTTTTTTGCTGTTGTTTGTTTATTTTGTTTTTCAATCTTTTCTATTGGTATTGCAG

ATGGATACATATAAAATACCTTACATAGACTAAGCTAGTCAATGTAGCCATAAAAACATAAGTTTTAATGAGGGAAATGAACTGGGGGTGATAAGTATTC

TAGTTGATATAAATCTGTTTTCTTGTGTTTAATGACAGTTATTTGAGACCTTAAGTACGATGTTTTTGTTACATTCTTTGTAACAGGAAGATTTTAGAAA

CAATATAATGGGCCTCAGTTAAAGTACAGGAAACTGATGGGATATTGGGAAGTCAACAGAAATCACATTTTTAAAGAAATGTTTATTGTC
Translation
MVLDSVARIVKVQLPAYLKQLPVPDSITGFARLTV - UNI16684 - - UNI16936 - VSDWLRLLPFLGVLALLGYLAVRPFFPKKKQQKDSLIN

LKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTVR
Transcript ENSMUST00000029815
Sequence
ATTCTAACCTCAGCCAAGATAGGTAAGTAAAACCACTCCAATACCTTTACATTTTACAAGACGTAAGCCCCGTGTCACAGAAACTCCACAAGACAAGCGT

GGTTATCCCAGCATTTGGAAGATGAAGATACTCATAGTTATCAGCCTCCTGAATGTCAGTTCAGGCTGGGTTACATGACTGTCTAAAAAAGGGGGTGGGG

GGCAAACACATTTCCCCCCTTTAAAAAGAAAAGCCTTTGACTGCTTGGGCAGAACTGACTAAAGTTGCGGAGGAAAAAACAATCAGTGGGTAACTTTGGG

TTTCTTTCAAAACCCGGCCACCCGCTTCCGCAGACGTCAAGGGTCGAAAGCGGACGCCCACCCCCGCAGCCGAGCCGAGGACAGGCCGGGCTCCGTACGC

TGGGCGCTGCGTTGCGCTCGGCTCCGCTCCGCAGCGCGCACGTCACTCGCCGCGCGCCAATCGCGGCCCGGCGGGCCACCTCCCGCCCGAGCCCGCGAGC

CCGCCGGCCGCTTCCGCTCTCACGCAAGCGCAGCAGCCGGGCAGCGGACGCCGCCGGCGGCAGGATGGTCCTGGACAGCGTGGCCCGCATCGTGAAGGTG

CAGCTGCCCGCCTACCTCAAGCAGCTCCCGGTCCCCGACAGCATCACCGGGTTCGCCCGCCTCACAG - UNI16684 - - UNI16936 - TTTCAG

ACTGGCTCCGCCTACTGCCCTTCCTCGGGGTACTTGCGCTTCTGGGCTACCTCGCAGTGCGCCCATTCTTCCCAAAGAAGAAGCAACAGAAGGATAGCTT

GATCAATCTTAAGATACAAAAGGAAAATCCCAAGGTGGTGAATGAGATAAACATTGAAGATCTGTGTCTCACCAAAGCAGCTTATTGTAGGTGCTGGCGG

TCCAAGACG - UNI2547 - - UNI16936 - TTTCCTGCCTGTGATGGATCCCATAATAAGCATAATGAATTGACAGGCGATAACGTGGGTCCTCT

CATCCTGAAGAAGAAAGAAGTATAGCAGTGGCCATTTGAGATGAAACTCTGACAGAGTGTTTCCATGTGTGTTGTGCATAGAAAAGTCTTTGGAAGTTTT

AACTCTCAGTACTGGTTGAATAATTATTTCTGCCAGTTATTTTCTTGCTACACTACTGCTTATATTTGGTACTTTATATAGTCAGTCATTTCTATAGAAA

TCAGATGGTCAAGTCTCATTCTGAAATTAAGTTTAATGTGTCTTTCAACAATAAAGTCAGCACTTCAGATTTTAATTAATTGGGAATTTAAAGTTTGACT

GTGGGCCAAAAGTTATTTCTTTGTATATCAGTATTTCAACAGAATACATAGTTTTAAAAAAATTATCCTTTGTTCTGTTAAATGTATCTTTATATTGTCT

TGTTTTGCTCATTTGAAGTCATTTGCCATTTTTTTGGCCTTTTGTGGAACTCTGCTGCTTTTAGAAGAATTATGAAAAATAATTGCCATCAACAATATTT

TGAGGCAGTAAAACCCCTTGTTTTATAGAGACTTTCATCTTATTACCATGATTATCCCAATTTCTAAAAAGTAAATCAGATATAAAAATTTCCAATTAGA

AACAATTATTTTCATCATAAAAATGGTTCACCTTACAAAAGCCTTGTTGTGTGTGTGAGGGTGTGAGGGTGTATATGTGTGTGTGAGTATGTGTGTGTGT

GTGAGAGAGAGAGAGTATGTGTGTGTGTGTGTGGTGCTTAACTTGGAGACTGCTGGGTGGCAAGAGCACTCATGAACTAGAGTTTGAAGATCAGTTAGAT

ATTAAATAACTGAATTTGCATTAAAATGATGCATAGTTCATTGCTCAAAATTATGTTTTATCTTTTCTGTTGTAAATTATAGAGAAACGGCAACAGGATA

TTAAGTTCTTGTATTCTAATGGATTGAATTTGTACATACTGAGAGAAAATATTTTGATCTTTTTTAAAAGAGATAACTCTTGTTGTATTTTTTTAACGTC

ACAAAATATAGATCAAACACTTGTGGGCATAATGACAGAAAAAAAGTCTGGAAGGACCAAGGACTATGACTATGACACAGCATGGTCCACTTGCACGGAT

AAGGACGAGGACTTAGCAAAGGTTGCTGCTTTTACTCTCTATTTCTCTTCCCCCCCCCCCCCCCCCGCAACAAACCTTTATATGCTTTGCTTTTAATTGA

TCTTTTCTTAATTGAGGCTTTGAATAGAATCGTCATAGCACAGTTAAGCTCTTTAGGCCCGAGTGATAAGACCTGATTGATTGTCTAAGGATAGGGTGGA

GCCAGCAGGGCAGGAAGCATCATCACAAGTGGATTAGACAGAGGCTGTTCGAGGAGAGGAAGCCACACACGTGTTACAGCAAATACTGAAAAAACCAAAA

CACCAACAGTCCTTTCACGTCTGGCTCCTAAGTGAAATGACACGTCAAGGGCAAGGTAGGCTAAATAAAGAAGGTGGGCTTTAAGTATGTACTTCAGTTC

TGCCGTGTTCCCCCAGAAGCAGGGTAAAAGCAAGACAGTTAAATCTGGGGACACTCACCTGTCTGCCTGCTGGAGTAGATGGACCATCTCTAGGATTTCT

TCTTTATTAAATGAGCACACAGTATGCCTGGTACCACATGAATTCTGTTTGTTCTCTTTCTTTAGCTATCCTATCTAGCAGTTTGAGAAAGACTAGTGAT

GGCAAGCTAAAAAGGAAAATGATTACCAGTCAACTTGTCACAAAATTAAGTTACACTGACACAGTTTGTAGTCTTAGTTTGTGTATTGTAAAGTGTAAAT

AATGTTAAAACAGACAGACATGTTTTAGAAAGACTTATTTCATGTGTATGAGTGCCTGTCTGCCTGTCTGTGTGTCTGTCTGTGCACCATGCACATGCCT

GGTGCCCGAGGAAGCCAGAGAGAATGTTGGATCCCTGGAACTGGAATTAACAGATAGTTGTGAGCTACCATGTGAATACTGGGAACTGAACCTGGTCTCC

TACAAGAACATCCAGTGCTATTAACAACTGAGCCATCTCTCTAACCCTATAAAACTTTTAATAAAAGAGGTTATGATTGGTTTGAAGTAGCAACTGAAAT

GTGGAAGGAAGTATTCCGAAAGGCAGAAGTGGTACAAAGCCGTGTCTGCTCACTCCACTCATGGTACTGAGGATGGAACCCAGGGCCTCCCACACCCTGG

CAAGAGCCCTTCACACTGAGCTCCGTCTTGAGTTGTATCTTTTCAATAGCATAAACCATTGAGACAAAATACAAGAAAGTTTTCCATATAGGTTTACTGG

AATTTTTGAATTATTTGTGATTTTAGCCTACTATCAGAAGTCTCTTTAGTTTTATTTTACAAGTCTCATGTAAGAGCTATTCTTAAACTATTAAAGATAC

AACCTACTCGTT
Translation
MVLDSVARIVKVQLPAYLKQLPVPDSITGFARLTV - UNI16684 - - UNI16936 - VSDWLRLLPFLGVLALLGYLAVRPFFPKKKQQKDSLIN

LKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKT - UNI2547 - - UNI16936 - FPACDGSHNKHNELTGDNVGPLILKKKEV

For any suggestions or comments, please send an email to unitrap@crg.es