Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028173 (Gpr177)
Chromosomal location
Chr 3: 159502701 - 159598797 (+)
Description
G protein-coupled receptor 177 Gene [Source:MGI Symbol;Acc:MGI:1915401]
RefSeq_dna
NM_026582 
RefSeq_peptide
NP_080858.3 
UniGene
Mm.6766 
MGI
MGI:1915401 
Uniprot/SWISSPROT
Q6DID7 
Uniprot/SPTREMBL
Q8CDZ6 
Human Ortholog
ENSG00000116729 (GPR177)
Omim not available
UniTrap UNI31980
Vector Insertion
Chr 3: 159503012 - 159535872
Public Clones IST14942C9 (tigm) IST14941F10 (tigm) IST14942C11 (tigm) IST14973H1 (tigm)
IST14948H11 (tigm) IST14941B9 (tigm) IST14861H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7136
Vector Insertion
Chr 3: 159576869 - 159577899
Public Clones RRJ528 (baygenomics) RRJ545 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000068952
Sequence
GCAGTCTCAGCTCTGGGCATCTGGGGAGCCCAAGCGGCTTCGCCCAGGCATCCGCGCGGGCGCCTGCGGTCTGTCCCACCTCCTCTGCTAACGCACCCTT

GAAGTTTTGCAGCACCAGGAAAAGAGGGCAAGGAAGAAGGAGAGGGGAAGCGAAAGCATACCCTAAAACATTTACTTAAAGGAGAAAAGAAAGGGGGTCG

CAGAAATGGCTGGGGCAATTATAGAAAACATGAGTACCAAGAAGCTCTGCATTGTTGGAGGGATTCTTCTGGTTTTCCAAATCGTTGCCTTTCTGGTGGG

AGGCTTGATCG - UNI31980 - CTCCAGCACCCACAACAGCAGTACCCTACACGGCAATAAAATGTGTGGATGTCCGTAAGAACCACCATAAAACAA

GATGGCTGGCGCCTTGGGGACCTAACAAGTGTGACAAGATCCGTGACATCGAGGAAGCAATTCCAAGGGAAATTGAAGCAAATGACATTGTGTTTTCTGT

ACACATTCCCCTCCCTTCTATGGAGATGAGTCCATGGTTCCAGTTTATGCTGTTTATCTTGCAGCTAGACATTGCTTTCAAGCTGAACAACCAAATCA G

AGAAAATGCAGAAATTTCCATGGATGTTTCCCTGGGTTACCGTGATGATATGTTTTCTGAATGGACTGAAATGGCCCATGAAAGAGTACCACGTAAACTC

AAATGTACTTTTACATCCCCCAAG ACCCCAGAGCACGAAGGTCGTTATTATAATTGTGATGTCCTTCCTTTCATGGAAATTGGGTCAGTGGCTCATAAG

TATTACCTTCTAAATATCCGGCTACCTGTAAATGAGAAAAAGAAAATCAATGTTGGAATTGGGGAGATAAAGGACATTCGGTTGGTG GGAATCCACCAA

AACGGAGGTTTCACTAAGGTATGGTTTGCTATGAAGACCTTCCTTACACCCAGCATCTTCATCATTATGGTGTGGTATTGGAGGAGGATCACCATGATGT

CCCGACCTCCAGTGCTTCTGGAAAA AGTCATCTTTGCCCTTGGGATTTCCATGACCTTTATCAATATCCCTGTGGAATGGTTTTCTATTGGATTTGACT

GGACCTGGATGCTGTTATTTGGTGACATCCGACAGGGCATCTTCTATGCAATGCTTCTTTCTTTCTGGATCATCTTCTGTGGCGAGCACATGATG GATC

AACATGAACGGAATCACATTGCAGGGTACTGGAAGCAAGTTGGACCAATTGCTGTTGGCTCCTTCTGCCTCTTCATATTTGACATGTGTGAAAG AGGAG

TACAACTCACAAATCCTTTCTACAGTATCTGGACTACAGATGTTGGAACAGAACTGGCT ATGGCTTTCATCATTGTGGCAGGTATCTGCCTCTGCCTCT

ATTTCCTGTTTCTGTGCTTCATGGTATTTCAGGTATTTAGAAACATCAGTGGGAAGCAGTCTAGCCTCCCAGCCATGAGCAAAGTCCGGAGGCTGCACTA

TGAG - UNI7136 - GGTCTGATCTTCAGGTTCAAGTTCCTCATGCTTATCACCTTGGCTTGTGCTGCCATGACTGTTATCTTCTTCATCGTTAGTCA

G GTGTCAGAAGGCCATTGGAAATGGGGTGGTGTCACAGTTCAAGTGAGCAGTGCTTTCTTCACTGGAATCTATGGGATGTGGAACCTGTATGTCTTTGC

TTTGATGTTCTTGTATGCACCATCCCATAAGAACTATGGGGAAGACCAGTCTAATG GTGACCTGGGTGTCCACAGCGGGGAAGAACTGCAGCTTACTAC

CACTATAACCCATGTAGATGGACCAACTGAGATCTACAAGTTGACCCGTAAAGAAGCACAGGAATAGGAGGCTATGGTATGGCACTGAGCTGGAATTGTC

TCTCTATCCAGCCTCTTCCCCTGGAGTAGAGATCCTACTATACAGAGCTCAGTGAAAAGTGGATACCTAGTGCTTCTTAGGTATAGTTTCTTAAAACAAC

AGATGGACATTTGTCAGATGACCTCCAATGGTGGCTGTTGCAAAACTTCTGCCACTACTATATAGCACATGTTAACAAAAACTGATATGACACATTTCCT

GTGATCATTGTTAATTAGTGACATAGCAGCATCTGTAGCAGGTGGGTTAGTAACCCTCACATAGAGGGGTATACTCCTTGGGATGGTTTGGGCCAATAGG

GGCTATATTGAGTAGTTTGTGACTTTTTTCTGCTTTTGATTCTGGGATATGTTTAAACATTCTTTGCAGTCCAACATTTGCTGATGTCATAGTCTTTTTA

CTCTCCTCCATGGGCACTTTTTTCTATTTATATCACCAAGTAGCCAAATGAGTTATTTAAGTTGTCAGTACAAATATGTCAACTTTTTAAAAAATGGATT

ACTATAAAATAACCAAACTTCATGAGAAATTTTATCTTACCAGAGGCATTTCAGCTTTGGAACCAAATCTGTGTATTTGATACTAATCTGTCTGTTTGTT

TGTGGATTTTGAGAAATATTTGCTTAACTACCCAAATAGGATTTCTGGTATTAAATGGCCTTTGGGTCCTAAAAGCTTTTTTTAACTTCTTGCTTAAAAT

GTGTTTTCTTTTGATAAGATTCTTCAAACAATCTCCAAAAGTGTAAATCTAATCATGTGAATAAAATGAATGTAAATATGCACCCCTTCCTGTCCCAACA

GTTCTCAGGCATACAGATTCAAATCTGCTTGGATCTTGGAGTACCCAGGTGCTGGCAGAAATAGCTTGAGTATTTCTGGAGGTGAAGGGATACCTTCTGT

ATCAAGTATTAAGCCATTCTAGGCCAGCAAGGAATGCTCACATACATGAGGAATCAGATGCTTTATACCCGCATACACAGCTCTCATTTCAGTACCCCTA

ATAGCCTATGACATTGCTTTTGTTTGTTTGCTTTTTATTTTATTTGTGCCTTTTTTAGATGCTAAAGAAGCCACATGACATAGCAGATAAAATACTCAAT

TCTGAATTTAAAAGGCCGTTTTCTATCGAAGGTCTATCATGCTCTAGTTGTGTGATGTTGTTCAAGCTATCTGACATAACTATTCCCCAAATTACAAGCT

AACATTCATAAAGTGTAACTGTCTTCAGGGTCACAATGAAAAAATAATTAATGTATCAGTTATACATCCGTATTGATTAACTTTGCAGTCTAAAAAAAAA

AATTCCATGAGAGTCTCATTGTTTAGGTAGCAATGATTGAAACAAAGTTTGTGGTATATTCTGTTTAATTAACCTACATGGCAAACCCCATCCTGTGTTT

TTCCTAACTTTGGCCAGAACCATGGTAAACAGTGACAGAG
Translation
MAGAIIENMSTKKLCIVGGILLVFQIVAFLVGGLIA - UNI31980 - APAPTTAVPYTAIKCVDVRKNHHKTRWLAPWGPNKCDKIRDIEEAIPREI

EANDIVFSVHIPLPSMEMSPWFQFMLFILQLDIAFKLNNQIR RENAEISMDVSLGYRDDMFSEWTEMAHERVPRKLKCTFTSPK TPEHEGRYYNCDVL

PFMEIGSVAHKYYLLNIRLPVNEKKKINVGIGEIKDIRLV GIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEK KVIFALGISMTF

INIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMM DQHERNHIAGYWKQVGPIAVGSFCLFIFDMCER RGVQLTNPFYSIWTTDVGTE

LA MAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYE - UNI7136 - GLIFRFKFLMLITLACAAMTVIFFIVSQ VSEGHWK

WGGVTVQVSSAFFTGIYGMWNLYVFALMFLYAPSHKNYGEDQSNG GDLGVHSGEELQLTTTITHVDGPTEIYKLTRKEAQE

For any suggestions or comments, please send an email to unitrap@crg.es