Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028184 (Lphn2)
Chromosomal location
Chr 3: 148478550 - 148652280 (-)
Description
latrophilin 2 Gene [Source:MGI Symbol;Acc:MGI:2139714]
RefSeq_peptide
NP_001074767.1 
UniGene
Mm.9776 Mm.472194 Mm.462301 
MGI
MGI:2139714 
Uniprot/SWISSPROT
Q8JZZ7 
Uniprot/SPTREMBL
Q0P6A0 Q3UQ39 
Human Ortholog
ENSG00000117114 (LPHN2)
Omim not available
UniTrap UNI8936
Vector Insertion
Chr 3: 148500702 - 148502072
Public Clones RST667 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4634
Vector Insertion
Chr 3: 148491533 - 148496825
Public Clones AR0388 (sanger) AR0396 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3134
Vector Insertion
Chr 3: 148484373 - 148485918
Public Clones DA0268 (sanger) YHC333 (baygenomics) YHA201 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106128
Sequence
AATGGTGTCTTCTGGCTGCAGAATGCGAAGTCTGTGGTTTATCATTATAATCAGTTTCTCACCGAGTACAGAAG GTTTCAGCAGAGCAGCCTTACCATT

CGGGTTAGTTAGACGAGAGCTATCCTGTGAGGGTTATTCTATAGACCTGCGATGTCCGGGCAGTGACGTCATCATGATCGAGAGTGCGAACTACGGTCGG

ACGGACGACAAGATCTGCGATGCAGACCCCTTTCAAATGGAGAACACAGACTGCTACCTCCCTGATGCCTTCAAAATCATGACTCAAAG GTGCAACAAT

CGAACACAGTGTATAGTAGTTACCGGGTCAGATGTATTTCCTGATCCATGTCCCGGAACTTACAAATACCTTGAAGTTCAATATGAATGTGTCCCTTACA

 AAGTGGAGCAAAAAG TCTTTGTGTGTCCTGGAACCTTGAAAGCAATTGTGGACTCACCATGTATATATGAAGCTGAGCAGAAGTCAGGGGCTTGGTGC

AAGGACCCCCTTCAGGCTGCAGATAAAATTTATTTTATGCCCTGGACTCCCTACCGCACCGATACGTTAATAGAATATGCCTCTTTAGAAGATTTTCAAA

ACAGCCGCCAGACAACAACATACAAACTTCCAAACCGAGTAGACGGTACTGGATTTGTGGTGTATGATGGAGCCGTCTTCTTTAACAAGGAAAGAACCAG

AAACATTGTTAAGTTTGACTTGAGGACTAGAATCAAGAGCGGCGAGGCTATCATCAACTATGCCAACTACCACGATACGTCACCCTACAGATGGGGTGGG

AAGACAGACATTGACCTCGCAGTGGATGAGAACGGCTTATGGGTCATTTATGCCACGGAGCAGAACAATGGAATGATCGTGATCAGCCAGCTCAACCCTT

ACACTCTTCGATTCGAGGCAACCTGGGAGACAGCGTATGACAAGCGTGCGGCGTCCAATGCTTTCATGATATGTGGGGTTCTCTATGTGGTCAGGTCAGT

GTACCAAGACAATGAAAGCGAAGCAGGCAAGAACACCATTGACTACATCTACAACACGCGACTAAGCCGGGGCGAGTACGTGGACGTTCCTTTTCCCAAC

CAGTACCAGTATATTGCTGCAGTGGATTATAATCCAAGAGACAACCAACTCTACGTATGGAACAATAACTTCATTTTACGGTATTCCCTGGAGTTTGGTC

CTCCTGACCCTGCCCAAG TGCCTACCACAGCTGTGACAATAACTTCTTCAGCTGAGCTGTTCAAAACCACAATATCCACCACGAGCAGTGCCTCCCAGC

GAGGCCCCGTGAGCAGCACTGCAGCTGGTCCTCAGGACGGAAGCAGAGGGACAAAGCCACCTCCAGCCGTCTCTACAACCAAAATTCCTCCTGTAACAAA

TATTTTTCCCCTGCCAGAGAGATTCTGCGAAGCGTTAGACTGGAAGGGGATAAAGTGGCCTCAGACACAAAGGGGGATGATGGTTGAGCGACCCTGTCCC

AAGGGAACAAGAG GGACGGCCTCGTATCTGTGCATGGCTTCCACGGGAACATGGAACCCGAAGGGCCCTGATCTTAGCAACTGCACGTCTCACTGGGTG

AACCAGCTGGCCCAGAAG ATCAGAAGTGGAGAGAATGCTGCGAGCCTGGCCAATGAACTAGCTAAGCACACCAAGGGGCATGTGTTTGCAGGGGACGTG

AGCTCCTCTGTGAGGCTGATGGAACAGTTGGTGGACATCCTGGATGCTCAGCTGCAGGAGCTGAAGCCGAGTGAGAAGGATTCGGCTGGGAGGAGCTATA

ACAAG CTCCAAAAACGAGAGAAGACATGCAGGGCTTACCTTAAG GCAATTGTGGACACGGTAGACAACCTTCTGAGAGCTGAGGCTTTGGAATCCTGG

AAACACATGAATTCTTCAGAGCAGGCGCACACAGCCACAATGTTGTTGGATACCTTGGAAGAAGGAGCATTCGTCCTAGCAGACAACCTTTTGGAACCAA

CCAGGGTCTCCATGCCAACAGAAAATATTG TTTTAGAAGTTGCTGTCCTCAGCACGGAAGGGCAGGTCCAAGACTTTAAATTCCCTCTGGGCTTAAAGG

GGTTGGGCAGCTCCATCCAGCTCTCTGCCAACACGGTCAAACAGAACAGCAGGAATG GGCTGGCCAAGCTGGTATTCATCATTTACCGGAGCCTGGGAC

AATTCCTAAGCACTGAGAACGCAACCATAAAGCTGGGTGCAGACCTCATGGGTCGGAACAGCACCATTGCGGTGAACTCTCCCGTCATCTCCGTCTCCAT

CAATAAGGAGTCCAGCCGCGTGTACCTGACAGATCCCGTGCTTTTCACACTGCCACACATTGAT - UNI8936 - CCTGACAATTATTTCAATGCAAA

CTGCTCCTTCTGGAACTACTCAGAGAGAACCATGATGGGATATTGGTCTACCCAGGGCTGCAAGCTGGTTGACACTAATAAAACTCGCACAACGTGCGCT

TGCAGCCACCTAACCAATTTTGCTATTCTCATGGCCCACAGGGAAATTGCG TATAAAGATGGAGTGCACCACCTGTTGCTGACAGTCATCACCTGGGTG

GGCATCGTTGTCTCCCTCGTCTGCCTGGCTATCTGCATCTTCACCTTCTGTTTCTTCCGAGGGCTACAAAGTGACCGCAATACTATCCACAAGAACCTTT

GTATCAACCTTTTCATTGCTGAATTTATTTTTCTCATCGGCATCGATAAGACAAAATACACG ATTGCATGCCCCGTGTTCGCAGGGCTTCTTCACTTTT

TCTTCCTGGCTGCTTTTTCCTGGATGTGCCTGGAAGGTGTGCAGCTCTACCTAATGTTGGTTGAGGTTTTCGAGAGCGAATATTCAAGGAAGAAATATTA

CTATGTCGCTGGGTACCTGTTCCCGGCCACAGTGGTCGGCGTCTCAGCAGCCATTGACTACAAGAGTTACGGGACAGTCCAGGC TTGCTGGCTTCACGT

TGATAACTATTTCATATGGAGTTTCATCGGGCCTGTTACTTTCATTATTCTG - UNI4634 - CTAAATATTATTTTCCTGGTGATCACGCTGTGCAA

AATGGTGAAACATTCAAACACTCTGAAACCAGATTCTAGCAGGTTGGAAAACATTAA TAATTACCGTGTTTGTGATGGCTACTATAATACGGACTTACC

TGG CTATGAAGATAATAAGCCATTTATCAA GTCTTGGGTACTTGGCGCGTTCGCCCTGCTGTGTCTCCTGGGCCTCACCTGGTCCTTTGGGTTGCTTT

TTGTTAACGAGGAGACTGTTGTCATGGCGTATCTCTTCACCGCCTTTAATGCTTTCCAGGGACTCTTCATTTTCATCTTCCACTGTGCTCTTCAAAAGAA

A GTACGAAAAGAGTATGGCAAGTGCTTCAGACACTGGTACTGCTGTGGCGGCCTCCCGACCGAGAGCCCGCACAGCTCTGTGAAGGCATCCACCACCCG

CACCAGTGCTCGGTACTCCTCTGGCACACAG AGCCGTATAAGAAGGATGTGGAATGACACCGTGAGGAAGCAGTCTGAATCGTCTTTTATCTCAGGTGA

CATCAATAGCACTTCTACCCTTAACCAAG - UNI3134 - GGATGACTGGCAATTACCTACTAACAAACCCTCTTCTCCGGCCCCACGGCACTAACAA

CCCCTATAACACCCTGCTCGCTGAAACAGTTGTATGCAATGCCCCTTCAGCTCCTGCGTTTAACTCGCCAG GACATTCACTGAACAATGCCCGGGACAC

AAGTGCCATGGATACTCTACCGCTAAATGGTAACTTCAACAACAGCTATTCCCTGCGCAAGGCGGACTACCACGACGGCGTGCAGGTCGTGGACTGTGGA

CTAAGTCTGAACGACACCGCGTTTGAGAAAATGATCATTTCAGAGTTAGTGCACAACAACCTCCGGGGCGGCAACAAAACCCACAACTTGGAGCTCAAGC

TCCCGGTTAAACCGGTGATTGGCGGCAGCAGCAGTGAAGATGACGCGATTGTGGCTGACGCCTCATCTTTGATGCATGGTGACAACCCAGGGCTGGAGTT

CCGCCACAAAGAGCTGGAGGCGCCGCTCATCCCCCAGCGGACTCACTCGCTTCTGTACCAACCCCAGAAAAAAGTGAAGCCGGAGGCAACAGACAGCTAC

GTCTCCCAGCTGACGGCCGAGGCCGACGACCACCTCCAGTCCCCCAACAGAGACTCTCTGTACACGAGCATGCCCAACCTAAGAGACTCTCCCTACCCGG

AGAGCAGCCCAGACATGGCAGAGGACCTGTCTCCCTCCAGGAGGAGTGAGAACGAGGACATTTACTATAAAAGTATGCCCAACCTTGGAGCTGGCCGCCA

TCTCCACATGTGCTACCAGATCAGCAGGGGCAATAGCGATGGTTACATCATCCCCATTAACAAAGAAGGGTGCATCCCTGAGGGGGACGTCCGGGAAGGA

CAGATGCAGCTGGTGACAAGTCTTTAATAGTACGGCTAAGGAATTCCTAGGGCCACATGCAAGTATTAATTGATAGAGACGCTGCCAGTGGGGCCCTGCA

GCTCCCTCCAACTCGGCCAGAAGACTCGGCTCTGTTGGCCCATGGTTCTCCACTTGTAGTAAAACGGATCAGACTGAACCTCACAGTCCTGTGAATTTTT

ATAAAACATGCAAAAACTTTGTATATACACAGAGTATACTAAATTGAATTATTTGTTACAAAGAAAAAAGAAATGCCAACCAGGTATTTTACGTTTCTGC

TGCTGTGTAGAGAGATTGTAAAACAAACAAGAGACCCTCCCTCCCGGCCATGTTCCTTGCGGCAGTTGGTGAACTGAGTCTGTAAATAGGGCCCTACCGG

TTTTTGTTTTTGTTTTGTTTTGTTTTTCTGTAGGCCTGCATTGTATTATATACAAGACGTAGGCTTCAAGATCCTGTGGGACAAATTGACTGTATCTTAC

TTTTCCTGACAAGACTTGGAAAAGCAGGAGAGAGATTCTGCACCCGTTTGCACTTCCCTGCAAACCTTTTACATTACGGCAACAACTGAAACCATGTCGA

ACCAGTAGCAATCAAGCCACAGGCCTTATTTCATGTCTTCTCAACTGTACAATGAACTATTCTCATGAAAAAAAAAATGGCTAAAGAAATTATATTTTGT

TCTATTGCTAGGGTAAAATAAATACATTTGTGTCCAACTAAAAATATCATTAAAATAATTTTAAAAGAGTTTGGAGAAAATATTGTGTCGAGCTCTTGGT

TGCACAAAATAGGCAAAGTTTCTTCTTCCACCCATCATGGTGACCTCTGCCCATCGTTGTTGATTTCCCACTGTAGACGGCGTCTGCTGCGGCCACTTAG

TCCCCTTTCTTACATTTAAATTTCTTATTGCCAAAAGAGTGTGTTTTATGGGGAGAAAACTTTTTGAAGTCCTGCCATGCCTTGCACAAATGTGGGGAAA

TCTGGAGGTCTTGAGTCACCCCTCTGTTTATTCTGGAACAGAGGGCGAAGGGGTCACCGGGCACTTCTCACAGACTTTCTAGTGAACAAAAGGTGCCTAT

TCTTTTTTAAAAAATAAAATAAAAATAAAATAAAACAGAAATATTACTCTTCCATATTCCTTCTGGCTATATTTAGTAATTAATTTATTTTATGGTAAAG

TTCTAATGACATGTAAATTGTTTCAGCAAAGCTCTGCTCTTCTTTCAAGCTCTTTGTGTAAAGCTGTTAATAACGAGCCTATTACTAATATCCAGTGTAA

AGTTTAACACGGTTTGACAGTAAATAAATGTGAATTTTTTCAAGTAGTAACGTGCACTTTTATGTATGTTAAGCAATAGACTCGACCAAGGTGGTCCTTT

CCAATCCCATCTCCCCCTCTGCTTAGGAACCCTCAGACTGTAACCATAGTTACGTATAAGAATGCAAGCATAAGTATAAGTTGGCCTGCTTATCCTTTGC

AGTGAGAAGAATAGATTTGTATCCTAATTATCTCTCATACAGAGACAAAATCTGTAAAATGAGTTGTAGTGGGAAGTAAAATTTTGTAAAATAAATGAAG

GATTATAATTCTAAC
Translation
MVSSGCRMRSLWFIIIISFSPSTEG GFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIESANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQR R

CNNRTQCIVVTGSDVFPDPCPGTYKYLEVQYECVPYK KVEQKV VFVCPGTLKAIVDSPCIYEAEQKSGAWCKDPLQAADKIYFMPWTPYRTDTLIEYA

SLEDFQNSRQTTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRTRIKSGEAIINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMIV

ISQLNPYTLRFEATWETAYDKRAASNAFMICGVLYVVRSVYQDNESEAGKNTIDYIYNTRLSRGEYVDVPFPNQYQYIAAVDYNPRDNQLYVWNNNFILR

YSLEFGPPDPAQV VPTTAVTITSSAELFKTTISTTSSASQRGPVSSTAAGPQDGSRGTKPPPAVSTTKIPPVTNIFPLPERFCEALDWKGIKWPQTQRG

MMVERPCPKGTRG GTASYLCMASTGTWNPKGPDLSNCTSHWVNQLAQK IRSGENAASLANELAKHTKGHVFAGDVSSSVRLMEQLVDILDAQLQELKP

SEKDSAGRSYNK LQKREKTCRAYLK AIVDTVDNLLRAEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLLEPTRVSMPTENIV VLEVAVLSTE

GQVQDFKFPLGLKGLGSSIQLSANTVKQNSRNG GLAKLVFIIYRSLGQFLSTENATIKLGADLMGRNSTIAVNSPVISVSINKESSRVYLTDPVLFTLP

HID - UNI8936 - PDNYFNANCSFWNYSERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIA YKDGVHHLLLTVITWVGIVVSLVCL

AICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFLIGIDKTKYT IACPVFAGLLHFFFLAAFSWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLFP

ATVVGVSAAIDYKSYGTVQA ACWLHVDNYFIWSFIGPVTFIIL - UNI4634 - LNIIFLVITLCKMVKHSNTLKPDSSRLENIN NNYRVCDGYYN

TDLPG GYEDNKPFIK KSWVLGAFALLCLLGLTWSFGLLFVNEETVVMAYLFTAFNAFQGLFIFIFHCALQKK VRKEYGKCFRHWYCCGGLPTESPHS

SVKASTTRTSARYSSGTQ SRIRRMWNDTVRKQSESSFISGDINSTSTLNQG - UNI3134 - GMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAP

SAPAFNSPG GHSLNNARDTSAMDTLPLNGNFNNSYSLRKADYHDGVQVVDCGLSLNDTAFEKMIISELVHNNLRGGNKTHNLELKLPVKPVIGGSSSED

DAIVADASSLMHGDNPGLEFRHKELEAPLIPQRTHSLLYQPQKKVKPEATDSYVSQLTAEADDHLQSPNRDSLYTSMPNLRDSPYPESSPDMAEDLSPSR

RSENEDIYYKSMPNLGAGRHLHMCYQISRGNSDGYIIPINKEGCIPEGDVREGQMQLVTSL
Transcript ENSMUST00000106127
Sequence
ATGGTGTCTTCTGGCTGCAGAATGCGAAGTCTGTGGTTTATCATTATAATCAGTTTCTCACCGAGTACAGAAG GTTTCAGCAGAGCAGCCTTACCATTC

GGGTTAGTTAGACGAGAGCTATCCTGTGAGGGTTATTCTATAGACCTGCGATGTCCGGGCAGTGACGTCATCATGATCGAGAGTGCGAACTACGGTCGGA

CGGACGACAAGATCTGCGATGCAGACCCCTTTCAAATGGAGAACACAGACTGCTACCTCCCTGATGCCTTCAAAATCATGACTCAAAG GTGCAACAATC

GAACACAGTGTATAGTAGTTACCGGGTCAGATGTATTTCCTGATCCATGTCCCGGAACTTACAAATACCTTGAAGTTCAATATGAATGTGTCCCTTACAG

TAAGTATGAAG TCTTTGTGTGTCCTGGAACCTTGAAAGCAATTGTGGACTCACCATGTATATATGAAGCTGAGCAGAAGTCAGGGGCTTGGTGCAAGGA

CCCCCTTCAGGCTGCAGATAAAATTTATTTTATGCCCTGGACTCCCTACCGCACCGATACGTTAATAGAATATGCCTCTTTAGAAGATTTTCAAAACAGC

CGCCAGACAACAACATACAAACTTCCAAACCGAGTAGACGGTACTGGATTTGTGGTGTATGATGGAGCCGTCTTCTTTAACAAGGAAAGAACCAGAAACA

TTGTTAAGTTTGACTTGAGGACTAGAATCAAGAGCGGCGAGGCTATCATCAACTATGCCAACTACCACGATACGTCACCCTACAGATGGGGTGGGAAGAC

AGACATTGACCTCGCAGTGGATGAGAACGGCTTATGGGTCATTTATGCCACGGAGCAGAACAATGGAATGATCGTGATCAGCCAGCTCAACCCTTACACT

CTTCGATTCGAGGCAACCTGGGAGACAGCGTATGACAAGCGTGCGGCGTCCAATGCTTTCATGATATGTGGGGTTCTCTATGTGGTCAGGTCAGTGTACC

AAGACAATGAAAGCGAAGCAGGCAAGAACACCATTGACTACATCTACAACACGCGACTAAGCCGGGGCGAGTACGTGGACGTTCCTTTTCCCAACCAGTA

CCAGTATATTGCTGCAGTGGATTATAATCCAAGAGACAACCAACTCTACGTATGGAACAATAACTTCATTTTACGGTATTCCCTGGAGTTTGGTCCTCCT

GACCCTGCCCAAG TGCCTACCACAGCTGTGACAATAACTTCTTCAGCTGAGCTGTTCAAAACCACAATATCCACCACGAGCAGTGCCTCCCAGCGAGGC

CCCGTGAGCAGCACTGCAGCTGGTCCTCAGGACGGAAGCAGAGGGACAAAGCCACCTCCAGCCGTCTCTACAACCAAAATTCCTCCTGTAACAAATATTT

TTCCCCTGCCAGAGAGATTCTGCGAAGCGTTAGACTGGAAGGGGATAAAGTGGCCTCAGACACAAAGGGGGATGATGGTTGAGCGACCCTGTCCCAAGGG

AACAAGAG GGACGGCCTCGTATCTGTGCATGGCTTCCACGGGAACATGGAACCCGAAGGGCCCTGATCTTAGCAACTGCACGTCTCACTGGGTGAACCA

GCTGGCCCAGAAG ATCAGAAGTGGAGAGAATGCTGCGAGCCTGGCCAATGAACTAGCTAAGCACACCAAGGGGCATGTGTTTGCAGGGGACGTGAGCTC

CTCTGTGAGGCTGATGGAACAGTTGGTGGACATCCTGGATGCTCAGCTGCAGGAGCTGAAGCCGAGTGAGAAGGATTCGGCTGGGAGGAGCTATAACAAG

 GCAATTGTGGACACGGTAGACAACCTTCTGAGAGCTGAGGCTTTGGAATCCTGGAAACACATGAATTCTTCAGAGCAGGCGCACACAGCCACAATGTTG

TTGGATACCTTGGAAGAAGGAGCATTCGTCCTAGCAGACAACCTTTTGGAACCAACCAGGGTCTCCATGCCAACAGAAAATATTG TTTTAGAAGTTGCT

GTCCTCAGCACGGAAGGGCAGGTCCAAGACTTTAAATTCCCTCTGGGCTTAAAGGGGTTGGGCAGCTCCATCCAGCTCTCTGCCAACACGGTCAAACAGA

ACAGCAGGAATG GGCTGGCCAAGCTGGTATTCATCATTTACCGGAGCCTGGGACAATTCCTAAGCACTGAGAACGCAACCATAAAGCTGGGTGCAGACC

TCATGGGTCGGAACAGCACCATTGCGGTGAACTCTCCCGTCATCTCCGTCTCCATCAATAAGGAGTCCAGCCGCGTGTACCTGACAGATCCCGTGCTTTT

CACACTGCCACACATTGAT - UNI8936 - CCTGACAATTATTTCAATGCAAACTGCTCCTTCTGGAACTACTCAGAGAGAACCATGATGGGATATTG

GTCTACCCAGGGCTGCAAGCTGGTTGACACTAATAAAACTCGCACAACGTGCGCTTGCAGCCACCTAACCAATTTTGCTATTCTCATGGCCCACAGGGAA

ATTGCG TATAAAGATGGAGTGCACCACCTGTTGCTGACAGTCATCACCTGGGTGGGCATCGTTGTCTCCCTCGTCTGCCTGGCTATCTGCATCTTCACC

TTCTGTTTCTTCCGAGGGCTACAAAGTGACCGCAATACTATCCACAAGAACCTTTGTATCAACCTTTTCATTGCTGAATTTATTTTTCTCATCGGCATCG

ATAAGACAAAATACACG ATTGCATGCCCCGTGTTCGCAGGGCTTCTTCACTTTTTCTTCCTGGCTGCTTTTTCCTGGATGTGCCTGGAAGGTGTGCAGC

TCTACCTAATGTTGGTTGAGGTTTTCGAGAGCGAATATTCAAGGAAGAAATATTACTATGTCGCTGGGTACCTGTTCCCGGCCACAGTGGTCGGCGTCTC

AGCAGCCATTGACTACAAGAGTTACGGGACAGTCCAGGC TTGCTGGCTTCACGTTGATAACTATTTCATATGGAGTTTCATCGGGCCTGTTACTTTCAT

TATTCTG - UNI4634 - CTAAATATTATTTTCCTGGTGATCACGCTGTGCAAAATGGTGAAACATTCAAACACTCTGAAACCAGATTCTAGCAGGTT

GGAAAACATTAA TAATTACCGTGTTTGTGATGGCTACTATAATACGGACTTACCTGG GTCTTGGGTACTTGGCGCGTTCGCCCTGCTGTGTCTCCTGG

GCCTCACCTGGTCCTTTGGGTTGCTTTTTGTTAACGAGGAGACTGTTGTCATGGCGTATCTCTTCACCGCCTTTAATGCTTTCCAGGGACTCTTCATTTT

CATCTTCCACTGTGCTCTTCAAAAGAAA GTACGAAAAGAGTATGGCAAGTGCTTCAGACACTGGTACTGCTGTGGCGGCCTCCCGACCGAGAGCCCGCA

CAGCTCTGTGAAGGCATCCACCACCCGCACCAGTGCTCGGTACTCCTCTGGCACACAG AGCCGTATAAGAAGGATGTGGAATGACACCGTGAGGAAGCA

GTCTGAATCGTCTTTTATCTCAGGTGACATCAATAGCACTTCTACCCTTAACCAAG - UNI3134 - GGATGACTGGCAATTACCTACTAACAAACCC

TCTTCTCCGGCCCCACGGCACTAACAACCCCTATAACACCCTGCTCGCTGAAACAGTTGTATGCAATGCCCCTTCAGCTCCTGCGTTTAACTCGCCAG C

AACCTACAGAGAGACAA GACATTCACTGAACAATGCCCGGGACACAAGTGCCATGGATACTCTACCGCTAAATGGTAACTTCAACAACAGCTATTCCCT

GCGCAAGGCGGACTACCACGACGGCGTGCAGGTCGTGGACTGTGGACTAAGTCTGAACGACACCGCGTTTGAGAAAATGATCATTTCAGAGTTAGTGCAC

AACAACCTCCGGGGCGGCAACAAAACCCACAACTTGGAGCTCAAGCTCCCGGTTAAACCGGTGATTGGCGGCAGCAGCAGTGAAGATGACGCGATTGTGG

CTGACGCCTCATCTTTGATGCATGGTGACAACCCAGGGCTGGAGTTCCGCCACAAAGAGCTGGAGGCGCCGCTCATCCCCCAGCGGACTCACTCGCTTCT

GTACCAACCCCAGAAAAAAGTGAAGCCGGAGGCAACAGACAGCTACGTCTCCCAGCTGACGGCCGAGGCCGACGACCACCTCCAGTCCCCCAACAGAGAC

TCTCTGTACACGAGCATGCCCAACCTAAGAGACTCTCCCTACCCGGAGAGCAGCCCAGACATGGCAGAGGACCTGTCTCCCTCCAGGAGGAGTGAGAACG

AGGACATTTACTATAAAAGTATGCCCAACCTTGGAGCTGGCCGCCATCTCCACATGTGCTACCAGATCAGCAGGGGCAATAGCGATGGTTACATCATCCC

CATTAACAAAGAAGGGTGCATCCCTGAGGGGGACGTCCGGGAAGGACAGATGCAGCTGGTGACAAGTCTTTAATAGTACGGCTAAGGAATTCCTAGGGCC

ACATGCAAGTATTAATTGATAGAGACGCTGCCAGTGGGGCCCTGCAGCTCCCTCCAACTCGGCCAGAAGACTCGGCTCTGTTGGCCCATGGTTCTCCACT

TGTAGTAAAACGGATCAGACTGAACCTCACAGTCCTGTGAATTTTTATAAAACATGCAAAAACTTTGTATATACACAGAGTATACTAAATTGAATTATTT

GTTACAAAGAAAAAAGAAATGCCAACCAGGTATTTTACGTTTCTGCTGCTGTGTAGAGAGATTGTAAAACAAACAAGAGACCCTCCCTCCCGGCCATGTT

CCTTGCGGCAGTTGGTGAACTGAGTCTGTAAATAGGGCCCTACCGGTTTTTGTTTTTGTTTTGTTTTGTTTTTCTGTAGGCCTGCATTGTATTATATACA

AGACGTAGGCTTCAAGATCCTGTGGGACAAATTGACTGTATCTTACTTTTCCTGACAAGACTTGGAAAAGCAGGAGAGAGATTCTGCACCCGTTTGCACT

TCCCTGCAAACCTTTTACATTACGGCAACAACTGAAACCATGTCGAACCAGTAGCAATCAAGCCACAGGCCTTATTTCATGTCTTCTCAACTGTACAATG

AACTATTCTCATGAAAAAAAAAATGGCTAAAGAAATTATATTTTGTTCTATTGCTAGGGTAAAATAAATACATTTGTGTCCAACTAAAAATATCATTAAA

ATAATTTTAAAAGAGTTTGGAGAAAATATTGTGTCGAGCTCTTGGTTGCACAAAATAGGCAAAGTTTCTTCTTCCACCCATCATGGTGACCTCTGCCCAT

CGTTGTTGATTTCCCACTGTAGACGGCGTCTGCTGCGGCCACTTAGTCCCCTTTCTTACATTTAAATTTCTTATTGCCAAAAGAGTGTGTTTTATGGGGA

GAAAACTTTTTGAAGTCCTGCCATGCCTTGCACAAATGTGGGGAAATCTGGAGGTCTTGAGTCACCCCTCTGTTTATTCTGGAACAGAGGGCGAAGGGGT

CACCGGGCACTTCTCACAGACTTTCTAGTGAACAAAAGGTGCCTATTCTTTTTTAAAAAATAAAATAAAAATAAAATAAAACAGAAATATTACTCTTCCA

TATTCCTTCTGGCTATATTTAGTAATTAATTTATTTTATGGTAAAGTTCTAATGACATGTAAATTGTTTCAGCAAAGCTCTGCTCTTCTTTCAAGCTCTT

TGTGTAAAGCTGTTAATAACGAGCCTATTACTAATATCCAGTGTAAAGTTTAACACGGTTTGACAGTAAATAAATGTGAATTTTTTCAAGTAGTAACGTG

CACTTTTATGTATGTTAAGCAATAGACTCGACCAAGGTGGTCCTTTCCAATCCCATCTCCCCCTCTGCTTAGGAACCCTCAGACTGTAACCATAGTTACG

TATAAGAATGCAAGCATAAGTATAAGTTGGCCTGCTTATCCTTTGCAGTGAGAAGAATAGATTTGTATCCTAATTATCTCTCATACAGAGACAAAATCTG

TAAAATGAGTTGTAGTGGGAAGTAAAATTTTGTAAAATAAATGAAGGATTATAATTCTAAC
Translation
     MASTGTWNPKGPDLSNCTSHWVNQLAQK IRSGENAASLANELAKHTKGHVFAGDVSSSVRLMEQLVDILDAQLQELKPSEKDSAGRSYNK AIV

DTVDNLLRAEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLLEPTRVSMPTENIV VLEVAVLSTEGQVQDFKFPLGLKGLGSSIQLSANTVKQNS

RNG GLAKLVFIIYRSLGQFLSTENATIKLGADLMGRNSTIAVNSPVISVSINKESSRVYLTDPVLFTLPHID - UNI8936 - PDNYFNANCSFWNY

SERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIA YKDGVHHLLLTVITWVGIVVSLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFI

AEFIFLIGIDKTKYT IACPVFAGLLHFFFLAAFSWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLFPATVVGVSAAIDYKSYGTVQA ACWLHVDNY

FIWSFIGPVTFIIL - UNI4634 - LNIIFLVITLCKMVKHSNTLKPDSSRLENIN NNYRVCDGYYNTDLPG GSWVLGAFALLCLLGLTWSFGLLF

VNEETVVMAYLFTAFNAFQGLFIFIFHCALQKK VRKEYGKCFRHWYCCGGLPTESPHSSVKASTTRTSARYSSGTQ SRIRRMWNDTVRKQSESSFISG

DINSTSTLNQG - UNI3134 - GMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPAFNSPA ATYRETR RHSLNNARDTSAMDTLPLNGNFN

NSYSLRKADYHDGVQVVDCGLSLNDTAFEKMIISELVHNNLRGGNKTHNLELKLPVKPVIGGSSSEDDAIVADASSLMHGDNPGLEFRHKELEAPLIPQR

THSLLYQPQKKVKPEATDSYVSQLTAEADDHLQSPNRDSLYTSMPNLRDSPYPESSPDMAEDLSPSRRSENEDIYYKSMPNLGAGRHLHMCYQISRGNSD

GYIIPINKEGCIPEGDVREGQMQLVTSL
Transcript ENSMUST00000037655
Sequence
ATGGTGTCTTCTGGCTGCAGAATGCGAAGTCTGTGGTTTATCATTATAATCAGTTTCTCACCGAGTACAGAAG GTTTCAGCAGAGCAGCCTTACCATTC

GGGTTAGTTAGACGAGAGCTATCCTGTGAGGGTTATTCTATAGACCTGCGATGTCCGGGCAGTGACGTCATCATGATCGAGAGTGCGAACTACGGTCGGA

CGGACGACAAGATCTGCGATGCAGACCCCTTTCAAATGGAGAACACAGACTGCTACCTCCCTGATGCCTTCAAAATCATGACTCAAAG GTGCAACAATC

GAACACAGTGTATAGTAGTTACCGGGTCAGATGTATTTCCTGATCCATGTCCCGGAACTTACAAATACCTTGAAGTTCAATATGAATGTGTCCCTTACAG

TAAGTATGAAG TCTTTGTGTGTCCTGGAACCTTGAAAGCAATTGTGGACTCACCATGTATATATGAAGCTGAGCAGAAGTCAGGGGCTTGGTGCAAGGA

CCCCCTTCAGGCTGCAGATAAAATTTATTTTATGCCCTGGACTCCCTACCGCACCGATACGTTAATAGAATATGCCTCTTTAGAAGATTTTCAAAACAGC

CGCCAGACAACAACATACAAACTTCCAAACCGAGTAGACGGTACTGGATTTGTGGTGTATGATGGAGCCGTCTTCTTTAACAAGGAAAGAACCAGAAACA

TTGTTAAGTTTGACTTGAGGACTAGAATCAAGAGCGGCGAGGCTATCATCAACTATGCCAACTACCACGATACGTCACCCTACAGATGGGGTGGGAAGAC

AGACATTGACCTCGCAGTGGATGAGAACGGCTTATGGGTCATTTATGCCACGGAGCAGAACAATGGAATGATCGTGATCAGCCAGCTCAACCCTTACACT

CTTCGATTCGAGGCAACCTGGGAGACAGCGTATGACAAGCGTGCGGCGTCCAATGCTTTCATGATATGTGGGGTTCTCTATGTGGTCAGGTCAGTGTACC

AAGACAATGAAAGCGAAGCAGGCAAGAACACCATTGACTACATCTACAACACGCGACTAAGCCGGGGCGAGTACGTGGACGTTCCTTTTCCCAACCAGTA

CCAGTATATTGCTGCAGTGGATTATAATCCAAGAGACAACCAACTCTACGTATGGAACAATAACTTCATTTTACGGTATTCCCTGGAGTTTGGTCCTCCT

GACCCTGCCCAAG TGCCTACCACAGCTGTGACAATAACTTCTTCAGCTGAGCTGTTCAAAACCACAATATCCACCACGAGCAGTGCCTCCCAGCGAGGC

CCCGTGAGCAGCACTGCAGCTGGTCCTCAGGACGGAAGCAGAGGGACAAAGCCACCTCCAGCCGTCTCTACAACCAAAATTCCTCCTGTAACAAATATTT

TTCCCCTGCCAGAGAGATTCTGCGAAGCGTTAGACTGGAAGGGGATAAAGTGGCCTCAGACACAAAGGGGGATGATGGTTGAGCGACCCTGTCCCAAGGG

AACAAGAG GGACGGCCTCGTATCTGTGCATGGCTTCCACGGGAACATGGAACCCGAAGGGCCCTGATCTTAGCAACTGCACGTCTCACTGGGTGAACCA

GCTGGCCCAGAAG ATCAGAAGTGGAGAGAATGCTGCGAGCCTGGCCAATGAACTAGCTAAGCACACCAAGGGGCATGTGTTTGCAGGGGACGTGAGCTC

CTCTGTGAGGCTGATGGAACAGTTGGTGGACATCCTGGATGCTCAGCTGCAGGAGCTGAAGCCGAGTGAGAAGGATTCGGCTGGGAGGAGCTATAACAAG

 GCAATTGTGGACACGGTAGACAACCTTCTGAGAGCTGAGGCTTTGGAATCCTGGAAACACATGAATTCTTCAGAGCAGGCGCACACAGCCACAATGTTG

TTGGATACCTTGGAAGAAGGAGCATTCGTCCTAGCAGACAACCTTTTGGAACCAACCAGGGTCTCCATGCCAACAGAAAATATTG TTTTAGAAGTTGCT

GTCCTCAGCACGGAAGGGCAGGTCCAAGACTTTAAATTCCCTCTGGGCTTAAAGGGGTTGGGCAGCTCCATCCAGCTCTCTGCCAACACGGTCAAACAGA

ACAGCAGGAATG GGCTGGCCAAGCTGGTATTCATCATTTACCGGAGCCTGGGACAATTCCTAAGCACTGAGAACGCAACCATAAAGCTGGGTGCAGACC

TCATGGGTCGGAACAGCACCATTGCGGTGAACTCTCCCGTCATCTCCGTCTCCATCAATAAGGAGTCCAGCCGCGTGTACCTGACAGATCCCGTGCTTTT

CACACTGCCACACATTGAT - UNI8936 - CCTGACAATTATTTCAATGCAAACTGCTCCTTCTGGAACTACTCAGAGAGAACCATGATGGGATATTG

GTCTACCCAGGGCTGCAAGCTGGTTGACACTAATAAAACTCGCACAACGTGCGCTTGCAGCCACCTAACCAATTTTGCTATTCTCATGGCCCACAGGGAA

ATTGCG TATAAAGATGGAGTGCACCACCTGTTGCTGACAGTCATCACCTGGGTGGGCATCGTTGTCTCCCTCGTCTGCCTGGCTATCTGCATCTTCACC

TTCTGTTTCTTCCGAGGGCTACAAAGTGACCGCAATACTATCCACAAGAACCTTTGTATCAACCTTTTCATTGCTGAATTTATTTTTCTCATCGGCATCG

ATAAGACAAAATACACG ATTGCATGCCCCGTGTTCGCAGGGCTTCTTCACTTTTTCTTCCTGGCTGCTTTTTCCTGGATGTGCCTGGAAGGTGTGCAGC

TCTACCTAATGTTGGTTGAGGTTTTCGAGAGCGAATATTCAAGGAAGAAATATTACTATGTCGCTGGGTACCTGTTCCCGGCCACAGTGGTCGGCGTCTC

AGCAGCCATTGACTACAAGAGTTACGGGACAGTCCAGGC TTGCTGGCTTCACGTTGATAACTATTTCATATGGAGTTTCATCGGGCCTGTTACTTTCAT

TATTCTG - UNI4634 - CTAAATATTATTTTCCTGGTGATCACGCTGTGCAAAATGGTGAAACATTCAAACACTCTGAAACCAGATTCTAGCAGGTT

GGAAAACATTAA GTCTTGGGTACTTGGCGCGTTCGCCCTGCTGTGTCTCCTGGGCCTCACCTGGTCCTTTGGGTTGCTTTTTGTTAACGAGGAGACTGT

TGTCATGGCGTATCTCTTCACCGCCTTTAATGCTTTCCAGGGACTCTTCATTTTCATCTTCCACTGTGCTCTTCAAAAGAAA GTACGAAAAGAGTATGG

CAAGTGCTTCAGACACTGGTACTGCTGTGGCGGCCTCCCGACCGAGAGCCCGCACAGCTCTGTGAAGGCATCCACCACCCGCACCAGTGCTCGGTACTCC

TCTGGCACACAG AGCCGTATAAGAAGGATGTGGAATGACACCGTGAGGAAGCAGTCTGAATCGTCTTTTATCTCAGGTGACATCAATAGCACTTCTACC

CTTAACCAAG - UNI3134 - GACATTCACTGAACAATGCCCGGGACACAAGTGCCATGGATACTCTACCGCTAAATGGTAACTTCAACAACAGCTAT

TCCCTGCGCAAGGCGGACTACCACGACGGCGTGCAGGTCGTGGACTGTGGACTAAGTCTGAACGACACCGCGTTTGAGAAAATGATCATTTCAGAGTTAG

TGCACAACAACCTCCGGGGCGGCAACAAAACCCACAACTTGGAGCTCAAGCTCCCGGTTAAACCGGTGATTGGCGGCAGCAGCAGTGAAGATGACGCGAT

TGTGGCTGACGCCTCATCTTTGATGCATGGTGACAACCCAGGGCTGGAGTTCCGCCACAAAGAGCTGGAGGCGCCGCTCATCCCCCAGCGGACTCACTCG

CTTCTGTACCAACCCCAGAAAAAAGTGAAGCCGGAGGCAACAGACAGCTACGTCTCCCAGCTGACGGCCGAGGCCGACGACCACCTCCAGTCCCCCAACA

GAGACTCTCTGTACACGAGCATGCCCAACCTAAGAGACTCTCCCTACCCGGAGAGCAGCCCAGACATGGCAGAGGACCTGTCTCCCTCCAGGAGGAGTGA

GAACGAGGACATTTACTATAAAAGTATGCCCAACCTTGGAGCTGGCCGCCATCTCCACATGTGCTACCAGATCAGCAGGGGCAATAGCGATGGTTACATC

ATCCCCATTAACAAAGAAGGGTGCATCCCTGAGGGGGACGTCCGGGAAGGACAGATGCAGCTGGTGACAAGTCTTTAATAGTACGGCTAAGGAATTCCTA

GGGCCACATGCAAGTATTAATTGATAGAGACGCTGCCAGTGGGGCCCTGCAGCTCCCTCCAACTCGGCCAGAAGACTCGGCTCTGTTGGCCCATGGTTCT

CCACTTGTAGTAAAACGGATCAGACTGAACCTCACAGTCCTGTGAATTTTTATAAAACATGCAAAAACTTTGTATATACACAGAGTATACTAAATTGAAT

TATTTGTTACAAAGAAAAAAGAAATGCCAACCAGGTATTTTACGTTTCTGCTGCTGTGTAGAGAGATTGTAAAACAAACAAGAGACCCTCCCTCCCGGCC

ATGTTCCTTGCGGCAGTTGGTGAACTGAGTCTGTAAATAGGGCCCTACCGGTTTTTGTTTTTGTTTTGTTTTGTTTTTCTGTAGGCCTGCATTGTATTAT

ATACAAGACGTAGGCTTCAAGATCCTGTGGGACAAATTGACTGTATCTTACTTTTCCTGACAAGACTTGGAAAAGCAGGAGAGAGATTCTGCACCCGTTT

GCACTTCCCTGCAAACCTTTTACATTACGGCAACAACTGAAACCATGTCGAACCAGTAGCAATCAAGCCACAGGCCTTATTTCATGTCTTCTCAACTGTA

CAATGAACTATTCTCATGAAAAAAAAAATGGCTAAAGAAATTATATTTTGTTCTATTGCTAGGGTAAAATAAATACATTTGTGTCCAACTAAAAATATCA

TTAAAATAATTTTAAAAGAGTTTGGAGAAAATATTGTGTCGAGCTCTTGGTTGCACAAAATAGGCAAAGTTTCTTCTTCCACCCATCATGGTGACCTCTG

CCCATCGTTGTTGATTTCCCACTGTAGACGGCGTCTGCTGCGGCCACTTAGTCCCCTTTCTTACATTTAAATTTCTTATTGCCAAAAGAGTGTGTTTTAT

GGGGAGAAAACTTTTTGAAGTCCTGCCATGCCTTGCACAAATGTGGGGAAATCTGGAGGTCTTGAGTCACCCCTCTGTTTATTCTGGAACAGAGGGCGAA

GGGGTCACCGGGCACTTCTCACAGACTTTCTAGTGAACAAAAGGTGCCTATTCTTTTTTAAAAAATAAAATAAAAATAAAATAAAACAGAAATATTACTC

TTCCATATTCCTTCTGGCTATATTTAGTAATTAATTTATTTTATGGTAAAGTTCTAATGACATGTAAATTGTTTCAGCAAAGCTCTGCTCTTCTTTCAAG

CTCTTTGTGTAAAGCTGTTAATAACGAGCCTATTACTAATATCCAGTGTAAAGTTTAACACGGTTTGACAGTAAATAAATGTGAATTTTTTCAAGTAGTA

ACGTGCACTTTTATGTATGTTAAGCAATAGACTCGACCAAGGTGGTCCTTTCCAATCCCATCTCCCCCTCTGCTTAGGAACCCTCAGACTGTAACCATAG

TTACGTATAAGAATGCAAGCATAAGTATAAGTTGGCCTGCTTATCCTTTGCAGTGAGAAGAATAGATTTGTATCCTAATTATCTCTCATACAGAGACAAA

ATCTGTAAAATGAGTTGTAGTGGGAAGTAAAATTTTGTAAAATAAATGAAGGATTATAATTCTAAC
Translation
     MASTGTWNPKGPDLSNCTSHWVNQLAQK IRSGENAASLANELAKHTKGHVFAGDVSSSVRLMEQLVDILDAQLQELKPSEKDSAGRSYNK AIV

DTVDNLLRAEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLLEPTRVSMPTENIV VLEVAVLSTEGQVQDFKFPLGLKGLGSSIQLSANTVKQNS

RNG GLAKLVFIIYRSLGQFLSTENATIKLGADLMGRNSTIAVNSPVISVSINKESSRVYLTDPVLFTLPHID - UNI8936 - PDNYFNANCSFWNY

SERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIA YKDGVHHLLLTVITWVGIVVSLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFI

AEFIFLIGIDKTKYT IACPVFAGLLHFFFLAAFSWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLFPATVVGVSAAIDYKSYGTVQA ACWLHVDNY

FIWSFIGPVTFIIL - UNI4634 - LNIIFLVITLCKMVKHSNTLKPDSSRLENIK KSWVLGAFALLCLLGLTWSFGLLFVNEETVVMAYLFTAFNA

FQGLFIFIFHCALQKK VRKEYGKCFRHWYCCGGLPTESPHSSVKASTTRTSARYSSGTQ SRIRRMWNDTVRKQSESSFISGDINSTSTLNQG - UNI

3134 - GHSLNNARDTSAMDTLPLNGNFNNSYSLRKADYHDGVQVVDCGLSLNDTAFEKMIISELVHNNLRGGNKTHNLELKLPVKPVIGGSSSEDDAI

VADASSLMHGDNPGLEFRHKELEAPLIPQRTHSLLYQPQKKVKPEATDSYVSQLTAEADDHLQSPNRDSLYTSMPNLRDSPYPESSPDMAEDLSPSRRSE

NEDIYYKSMPNLGAGRHLHMCYQISRGNSDGYIIPINKEGCIPEGDVREGQMQLVTSL
Transcript ENSMUST00000098518
Sequence
CCTCCGCGGCTGTGCAGCGGCGCTGCTCCTCCTCGCTCCTCCCGTCGCTCTCCCCGAACCCGAGTTCCTCACCTCCTGCATCCGCCGGGCGCCCCCTCTC

CCGCCCCCCAGCCCGGGAGACCCGACATGTGAGGAAGGGCTGGCGGCAGAGTCGTGCCCCAGGCCGCAGGGGCGGCGCGTGCGCCGGATGCAGGTCCTGC

CGCCGCTGCCCGCGCGCACCGGGCTCCTCCGGACTGACTGACGGACTTGGCCTCGCTCCCCGGCGGCCGTACTCCCGCCGCGGCTAGGGGACTCCGGAGT

CGGCGCACCTCCGCCAGCCTTGCTCTCTCATCCCCCGCATCTTTTGGTTTTGATTTTTGATTTTTTTTTCCGGCTCCGGAGGGAGCGTGCAGCGGTAGGC

GCGCGCGTGTGTGGGCAAAGCCCCCAGGGTCGCGGAACGGCGTGTGGGAAACTGCGGGAAGATGTTGACTTAGCCCCCCGGCAGCCGCCCGGGCCGCTGG

GCTGCTTGGCTGGACTCGGCGGCTGACGGCGGTGGAGACTCGAGTCGGAGGACACGCCGAAGAGCCGCGCGGCGCCGTGTCCGGCCCGCCAGCCGCCGCC

TCCCCGCGCGCGCTCAGCCAGCAGGAGCACCCCGCGCCGGTCGCCTCGGCCCTTCCTTCGCGCCCGTGTCCCCGCGCGGCTCCCCGCGCCAGATTGGCCC

TCCCCCGGGGCGCGCTCGCACACCGAG ATATGAGGATCAATGATGCAGACTGCTGGGTTCGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAAT

ACAAAGAAAATATTTAAAGGGATCAATAATGGTGTCTTCTGGCTGCAGAATGCGAAGTCTGTGGTTTATCATTATAATCAGTTTCTCACCGAGTACAGAA

G GTTTCAGCAGAGCAGCCTTACCATTCGGGTTAGTTAGACGAGAGCTATCCTGTGAGGGTTATTCTATAGACCTGCGATGTCCGGGCAGTGACGTCATC

ATGATCGAGAGTGCGAACTACGGTCGGACGGACGACAAGATCTGCGATGCAGACCCCTTTCAAATGGAGAACACAGACTGCTACCTCCCTGATGCCTTCA

AAATCATGACTCAAAGGTAGATGCATGTGCACACATGTCCTGTGTTTGCTACTGTGAGGTTAACCTGTGAGGGTTAAAGTTTCTGTCTGCCCCAAGGGAG

CAGATGCTGCCCTCAGCGAAGCTTTTGTCTAGGCGGTTAGATTTTTCCTCCCCTATGTTAACATCTATATTGTATTATGCTTCTGCCACATATAAAGTTT

GCATATCATCTTAGTAGAGAATATATAGGAATTCAGACCACATTCCCTTATTTTATAGAAAATAAGAAGGAAGAGTTCAAATCTAAGCTTGTTTCTTGAG

AATTTGAAGTCTTTTCTTTAGTCAAAAAGAATGTTTATCTGTCTGGAACTTTATCAGTAATTGCTTACTCTTAGTATGTTTCCAGTGAGTTTTTACAGCA

GTTTAAAGTCACACCAAAATTAAGTACTCTGTGTGTGTGTGTGTGTGTGTGTGTGTGTAGAGTCTGATGTGAACTTGAGTTTTCAAGTTTATATGGGTTA

AATACTCATATTTGCAACTGTTGGGTTATATAGTAAATGTTTATTCTGATTCATAAGAAACCTTCATTTGGGTTTGGTATAGCTTACCTATAAACCCTGG

CTCGTAGCAGGCTGAGGAAGGAAGATTATGAGTTTTAGGGTTCTAGGCCATCCTGAACTACATGGAGAAATCCTTTCCCATGCCATGCTCTTCCTCACCC

AGCTCTCACTGGTGAGAGGAGGCGTGGTGCAGGACCCATGAGCTGTCCTCCAGAGTGGCTGCTTCACTATTCCTCTTTGCTACAGAAGAAGAAGGTGGGA

GTTGCCCACACTTTCCCTCCATTTAGTGTTGACAGGGTTTGAATGTTAGCCATTTTATAAACATCTCCATGTTTCATTTATCATCCCTTAATGACCCAGA

GCACCGAGCTCCTTCCCTTTCTTCCTGTGTGTTCTTGAGATAGTGTCTATTTGTTCCAAGTATGCCCCTGTTTCTATAACTCCTGCTGCTAGTTTTGTTT

TAAGGATTCTTGGTATACTTGGGGTGGAAGCTACTTTCTCAGTTGTGTCCTATGTAACGGTTTCCAACATGTTGCTGGCTTTTGTCCTGTGCTCTTGGTC

CTTAACCTTAAGAGCAGCAACAGTACAGGGACAGGTGCAAGCTCAGCTCAGAGAGCATGTAGCTAAGTCTGTCCTGAACTAGAGAGGAAGGCCTTCTAAA

AACGTCGTCCAGTGTCTGTGTGTTGACAGTTTTTATCTTCACAAAGCCATAACTGCAGTGGAGGTTAGTAGAGTTTTGGAGCTATGCTGACCATGTAATA

CGTAGACTAAAATTGACATGCAAGGTTTATTTCTGCATAGTAATGAAGGTATCTGTCTTCCTCAAACAGTGCATAGATAAACATATTCTAATAAGGTTCT

TCTCTGGAATCTAAGCAACCCCCACTCCACCCTTCTTTACTTTTTTCGTTATTTCAACATGATTCTGAGAATAAATATATGTTATTT
Translation
 MVSSGCRMRSLWFIIIISFSPSTEG GFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIESANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQR

For any suggestions or comments, please send an email to unitrap@crg.es