Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028187 (Bxdc5)
Chromosomal location
Chr 3: 146169312 - 146184372 (-)
Description
brix domain containing 5 Gene [Source:MGI Symbol;Acc:MGI:1917535]
RefSeq_peptide
NP_081647.2 NP_081608.1 
MGI
MGI:1917535 
Uniprot/SWISSPROT
Q7TND5 
Human Ortholog
ENSG00000117133 (BXDC5)
Omim not available
UniTrap UNI4256
Vector Insertion
Chr 3: 146175876 - 146180689
Public Clones AJ0459 (sanger) (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029838
Sequence
GCCGTAAACAACATGGCGAAGGCCGGCGAGAAAAGTGTTGGTGGCGGCAAGCGAGGCTTGAAGAGGAAAGCTGCCGCTGAAGAGCCTCAAGAGGCTGCGG

CCGCGAGCGATGGGACGGCGGAGAGCGGGGTGCAGCCCGCGAAAGCGGCCGCCTTCCCCCCGGGCTTCAGTATCTCGGAGATTAAGAACAAGCAGCGGCG

ACACTTGATGTTCACGCGGTGGAAACAGCAGCAGCGGAAG GAAAAGTTGGCAGCTAAGAAAAAACTTAAAAAGGAGAGAGAGGCTCTTGGCGATAAG G

CTCCACCAAAGCCTGTTCCCAAGACCATTGACAACCAGCGCGTTTACGACGAGACCACAGTAGACCCCAATGATGAAGAG - UNI4256 - GTGGCTT

ACGATGAAGCGACGGATGAATTTGCTTCTTACTTCAACAGACAGACGTCTCCTAAGATTCTTATCACAACGTCAGATAGACCTCATGGG AGAACAGTTC

GACTCTGTGAGCAGCTCTCAACAGTTATACCAGATTCACATGTTTATTACAGACGAGGACTGGCTCTGAAAAAAATTATCCCACAGTGCATTGCAAGAGA

TTTCACAGACCTGATCGTTATTAATGAAGATCGTAAAACACCGA ATGGACTTATTTTGAGTCATTTGCCAAACGGTCCAACCGCTCATTTTAAAATGAG

CAGTGTTCGTCTTCGTAAAGAAATTAAG CGAAGAGGCAAAGACCCCACAGAACATGTACCTGAGATAATTCTGAATAATTTTACCACACGGCTAGGCCA

TTCTATTGGACGCATGTTTGCTTCTCTCTTTCCTCATAATCCTCAATTTATTGGAAGACAAGTTGCCACGTTCCACAATCAGCGAGATTACATCTTCTTC

AGGTTTCACAG ATACATATTCAAGAGTGAGAAGAAAGTGGGAATTCAGGAACTCGGACCACGTTTTACCTTAAAATTACGATCTCTTCAGAAGGGCACT

TTTGATTCTAAATATGGAGAGTACGAATGGGTCCACAAG CCACGGGAAATGGATACAAGTCGAAGGAAATTCCACTTATAAAGGACTAGGGGAGCAGTA

CTGAATTTTGCTGGATTGGCCTGTCTTGAAAAACTTGGTAATTCAATGAAACACCCTTTTCAAAATGGAATTTGATTTTATAAATCATGTATTTGAACAA

ATGACCAAGTACTGTGAATTTCTACTCCATATAGTAAATATAAATAAATATAATTTTATTTAGGTCTG
Translation
MAKAGEKSVGGGKRGLKRKAAAEEPQEAAAASDGTAESGVQPAKAAAFPPGFSISEIKNKQRRHLMFTRWKQQQRK EKLAAKKKLKKEREALGDK APP

KPVPKTIDNQRVYDETTVDPNDEE - UNI4256 - VAYDEATDEFASYFNRQTSPKILITTSDRPHG RTVRLCEQLSTVIPDSHVYYRRGLALKKII

PQCIARDFTDLIVINEDRKTPN NGLILSHLPNGPTAHFKMSSVRLRKEIK RRGKDPTEHVPEIILNNFTTRLGHSIGRMFASLFPHNPQFIGRQVATF

HNQRDYIFFRFHR RYIFKSEKKVGIQELGPRFTLKLRSLQKGTFDSKYGEYEWVHK PREMDTSRRKFHL

For any suggestions or comments, please send an email to unitrap@crg.es