Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028188 (Spata1)
Chromosomal location
Chr 3: 146120167 - 146162717 (-)
Description
spermatogenesis associated 1 Gene [Source:MGI (curated);Acc:Spata1-001]
RefSeq_dna
NM_027617 
RefSeq_peptide
NP_081893.1 
UniGene
Mm.383235 
MGI
MGI:1918201 
Uniprot/SWISSPROT
Q9D5R4 
Human Ortholog
ENSG00000122432 (SPATA1)
Omim not available
UniTrap UNI25584
Vector Insertion
Chr 3: 146156808 - 146157919
Public Clones not available
Private Clones OST175239 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33060
Vector Insertion
Chr 3: 146132588 - 146138346
Public Clones IST12696A11 (tigm) IST14957G10 (tigm) IST15026H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34900
Vector Insertion
Chr 3: 146128872 - 146131169
Public Clones IST10414A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029839
Sequence
GAAGGGGCGGAGCGGCCGGTGGGCGCGGTGGCGACGGGGGCGGTGCGGCCCGACGCCCGGCCGGCGCCTTCCGCCTCTGGAGGGGCTGGGTAGGGCGAG 

- UNI25584 - AGACCAGAAATAGCTGGAATGCTATCTTAAACCAAAAATCTATTTAAATACTTACTTAATGCTGCTTAAATGAAGAAAGATATATTA

ACTATCCAAAACTCCACCTGATAACTATCCCATTGAGACACTGGACAACATGTCGCTCAATCCAAGTCGACCATCTTCATCAGAG TTGGTGGAACTTCA

TGTTTTTTATGTCCCTGAAGGATCGTGGAACTATAAATTAAATACTATTTCAATAGAAGTTATTAACAACTTTATTTCTGCTGGATTTATAAG AGTATC

TCCTCAGCTTACCTTACAAGCTCTGAGGGAGCGTCTTGGGGAGTTTCTTGGTGTAGATGCTGTTGCAGAAAAATTTTTGTTTCTGAAATGCATTGGAAAT

AATTTAGCTGTG GTAAAGGAAAAGCAAGAATCAGAACTGAAACTCAAATCATTTGCTCCTCCATAT GCTCTTCAACCAGAATTATATTTGCTTCCTGT

AATAGATCACTTAGGAAATGTTTATTCAGCATCAACAGTTACTTTAGATGAACAGGAGAGTATTAATGATACTACGGAGATTAATGGAACAATCTACAGA

CCAGATAGTGTATCTTTGTCAAAGGATGAACCTGGAAATCCAAGTTTGTTGGAAAATACATGGAGAGACTTTACAAATCAGGAAGAAG CTGAGGAAAGC

CAACCTACACAAAATCACTTTGGAAATTCCAAGTTGCTGGGATCATTGGAAGAATCAAACGATTATTTTGGGAACCTAAAAAG TCCATTTCTTTGGAAA

AATGATGATGAGGAGGAGGATGAGGAGAAGGATAACGCAGCTCTCAGCAGAAGGCAGGCCACACTG GTGTGTGACAAGGAGTGCACTGCCCTGCCAGAT

CTGATTGATTTCCCTTCATTTCCTTCTCAGCGGGTTTCTTCAAGATTAACTGATACCTCTTTATTAAAAATTGAGA - UNI33060 - GAGAGAAGAT

TATTGAACAAATGAAACAAGTAAAGGAAGAACGAAAATATCTGGAAAATATTAGAGAAGAACTAATAAAAAAAGTTGATAAGCTATTTGAACAAAATAAA

TCGAAACGATATCATG - UNI33060 - CCTCTGACAGCTGGAAGAAAAAATACCTTGACACCAAGAAAGTCACAGCATCATTGGAGGAAGTTTTAAC

AAAACTTCGAGAAGATTTGGAACTTTACTATAAAAAACTGCTCATGCAGCTTGAAGCCAGGGAGATCAAGATGCGACCAAGGAATTTGGCAAATATCTCA

GATTCTAAG - UNI33060 - - UNI34900 - AATTATCTTATAATCCAGATTACTGAAGTACAGCACGCAATTGACCAACTTAAGAGAAAATTGG

ATACTGATAAAATGAAACTCATATTAGAAGTTAAG - UNI34900 - ATGAGAAAACAAGCAGTTTCAGATTTACAGACATTAAAAGCTGATCTGACA

CAGAAGAAAATGGGTGCACCTTTCCGACCTCCGATGT - UNI34900 - TTTCTGGAAGTGTGCCAACCTAGAAGTTCAACAGATGAATATTGTGTGT

GATAAATCAGCCAGATGAACAG TTAATGTCTGATTGTAGGGAGCATTGGCGGCTGCAATACATTCTGACCAGATCTGACTTTGCTCATCGTAAGACATC

ACAAAAAGAAAGTCACAGGCATCTGCGATCCCAGTGTAATTATAGCACCTTTTGTCTATGCGCTTTGGTGACCAAGCTACATCAAAGGTTACCTGTGGAA

AAACTACATATTATTTACATAACATTTCCTTGCCTTATTCTACTCAAAAATAAAGAAATGCTTATAATGTATGCATATAGAACTTAATACATGTAGAAGA

GCTCTAATAAATATGTTTTGTTACT
Translation
 - UNI25584 - MSLNPSRPSSSE LVELHVFYVPEGSWNYKLNTISIEVINNFISAGFIR RVSPQLTLQALRERLGEFLGVDAVAEKFLFLKCIGN

NLAV VKEKQESELKLKSFAPPY ALQPELYLLPVIDHLGNVYSASTVTLDEQESINDTTEINGTIYRPDSVSLSKDEPGNPSLLENTWRDFTNQEEA A

EESQPTQNHFGNSKLLGSLEESNDYFGNLKS SPFLWKNDDEEEDEEKDNAALSRRQATL VCDKECTALPDLIDFPSFPSQRVSSRLTDTSLLKIER -

 UNI33060 - REKIIEQMKQVKEERKYLENIREELIKKVDKLFEQNKSKRYHA - UNI33060 - ASDSWKKKYLDTKKVTASLEEVLTKLREDLE

LYYKKLLMQLEAREIKMRPRNLANISDSK - UNI33060 - - UNI34900 - NYLIIQITEVQHAIDQLKRKLDTDKMKLILEVK - UNI34900

 - MRKQAVSDLQTLKADLTQKKMGAPFRPPMF - UNI34900 - FSGSVPT 
Transcript ENSMUST00000093951
Sequence
GCTTGGCTTAGTTCTGCTCCACTGGTCTGTTCTCAGGGGACATTTCACTTGGGCATGTGCGCCTGATTCATCACATCTAATGGAGACCTCTATTCTCTCC

GTCCTTTCTCCTTCGTCTCCTCTTCCTTCCTTATGGTCCCTACATGTGATCCTCAGCCTG - UNI25584 - AGACCAGAAATAGCTGGAATGCTATC

TTAAACCAAAAATCTATTTAAATACTTACTTAATGCTGCTTAAATGAAGAAAGATATATTAACTATCCAAAACTCCACCTGATAACTATCCCATTGAGAC

ACTGGACAACATGTCGCTCAATCCAAGTCGACCATCTTCATCAGAG TTGGTGGAACTTCATGTTTTTTATGTCCCTGAAGGATCGTGGAACTATAAATT

AAATACTATTTCAATAGAAGTTATTAACAACTTTATTTCTGCTGGATTTATAAG AGTATCTCCTCAGCTTACCTTACAAGCTCTGAGGGAGCGTCTTGG

GGAGTTTCTTGGTGTAGATGCTGTTGCAGAAAAATTTTTGTTTCTGAAATGCATTGGAAATAATTTAGCTGTG GTAAAGGAAAAGCAAGAATCAGAACT

GAAACTCAAATCATTTGCTCCTCCATATGTATGTACTATGATGTTAAACTCACACTAATTTTAAAATTTAAAGTTGATTTTGTTGGTTTTGACCTTTTAA

AAAAATTTCCTATGTTTTAGGCTCTTCAACCAGAATTATATTTGCTTCCTGTAATAGATCACTTAGGAAATGTTTATTCAGCATCAACAGTTACTTTAGA

TGAACAGGAGAGTATTAATGATACTACGGAGATTAATGGAACAATCTACAGACCAGATAGTGTATCTTTGTCAAAGGATGAACCTGGAAATCCAAGTTTG

TTGGAAAATACATGGAGAGACTTTACAAATCAGGAAGAAGGTGATTTCAACTAAAATGGGAGAGGCAAGAGTTTCTTATAGATAATAAATTGGAGCAACC

AAGCCTATTTGCAAATTTTGGGCAAACTTACCTTACAAATTACAGGCAAGGAAAGCTTCAACTCAAGAGGGGCTTTAAAATGGACAAGTGGGGGAAACAC

AATAAAATACTTTGTTAAAAATGAATTAAGAGCTAGGGAGGCAGTTCAGGGTGTAATGTGTTAGACTTGCAAACATAAGGACCTACATTCAGGCCACAGA

ACCTGGGTAAAACAACAAACAAACAAGCTGAGCATGATGGTGCGCAGTTGGACCCCAGCATTCGGGAGTCAGAGACAGGGAGGTCCTTGCGATTGTCTAG

CCTACCTAGGCTGGCCTACTTGCTGAGCTCCAATCCAGGGAGCTATCTCAAAAGCACAATGGTCAGAACTGGAACGATGATTCAGAGATGTGTTTACTGT

TCTTACTTAGCACCTGAGTTTGGTTTCCACCATCCACATCAGGCTGCTCTCAATCTCCAATCCAGGAGATGTGCTGCCCTCTTCTGGTCTCCATAGACAC

CTGTACCTGTCTATAACCCCACACAGGCACACACGGAGGTAGATGGCACTTGAAGAAGGACACTTAAGATTGACTTCTGGTCTCCACATGCACATGTGTA

CACACACCCATACACACGGGTGCACCTACATATACACATGTACACAAAGTGGCAAATAACCAAAATATTTTCATTAAAGTAAGTTTACAGAAACAGAACT

ATATAGAAAAATGTCAGTTGAACATTTTCATCATATTTCATAGGCAAATAAGGTATGCAAGGGCAAAATTGGTATAGTATATGTAAGTGAAATATATCTC

CCCAAAACTAATGACAGTATCCATTACAGCTGCAGGGTATTGCTTTGTAATTATATTTCTTATCATCTCAATTTATTCTACACCAGATGATATTTCAAAC

TTATTGTTTTTGACTTTTCTATGCCTCCTATAGCTCCCAAATAAAGACATGGTGACCCTATATTTATTACAAGATCCTTATACTATTGCTGGCCAGATAC

TGAGCTATTCTGTCTAATCTACCCAGCCACGTGCCCCATTACTTGCCATCTTAGTCCTGTCTTGGTTGCTTCTGCTCCATCAGTATCCTTATGACCACTT

CCCTTGGTGACCTGCTTATGACCAGTGATCATGTTGAAGCTTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCT

CCTTTTCTCATTCTCCCTCTCCTCCATCCCCCTGCCTTTGTGGTGCCTACTTGAGACCCTCTCTGGGATTTGAAGTTCCAAATTGGCTGGCCAGCCCTTT

ATTAACCAATCAGAGGTAATGGAAAACATTTTTTATTCAACATTGAGATGGAGATGCTTGATAATGTAGATGTCTGGACTGCAATCAGATCTCTGGATAC

TGCAATCTGCATCTGAGTACACAGTGCACAAAACCATTCCCCAACAAATGCCTTTAATATTCTCTGCATTAATATTTAGTATCAGATGATACCACTGAGA

TAGATACTTTATCTTGGCATGTACATGTCATTCATGGTAATTCCCTTAAAAACTAAAGAGAGGCCGGGCGTGGTGGCACATGCCTTTAATCCCAGCACTT

GGGAGGCAGAGGCAGGCGCATTTCTGAGTTCAAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGACAGCCAGGGCTATACAGAGAAACCCTGTCTCAAAA

AAAAAAAAAAAAAAAAAACTAAAGAGAAA
Translation
 - UNI25584 - MSLNPSRPSSSE LVELHVFYVPEGSWNYKLNTISIEVINNFISAGFIR RVSPQLTLQALRERLGEFLGVDAVAEKFLFLKCIGN

NLAV VKEKQESELKLKSFAPPYVCTMMLNSH

For any suggestions or comments, please send an email to unitrap@crg.es