Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028248 (Sfrs18)
Chromosomal location
Chr 4: 21775195 - 21803614 (+)
Description
splicing factor, arginine/serine-rich 18 Gene [Source:MGI (curated);Acc:Sfrs18-001]
UniGene
Mm.474302 Mm.408245 Mm.468680 Mm.100117 
MGI
MGI:1913875 
Uniprot/SWISSPROT
A2AJT4 
Uniprot/SPTREMBL
A2AJT3 Q3TV92 Q8BZE7 A2AJT5 B2RUA1 
Human Ortholog
ENSG00000132424 (SFRS18)
Omim not available
UniTrap UNI29607
Vector Insertion
Chr 4: 21775287 - 21781493
Public Clones (sanger) E139E02 (ggtc) D049E02 (ggtc) D127A05 (ggtc) IST14389B1 (tigm)
IST10458E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23960
Vector Insertion
Chr 4: 21781493 - 21781593
Public Clones not available
Private Clones OST239320 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20909
Vector Insertion
Chr 4: 21784516 - 21786230
Public Clones not available
Private Clones OST348521 (lexicon) OST320810 (lexicon) OST245374 (lexicon) OST242143 (lexicon)
OST212273 (lexicon) OST193851 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108229
Sequence
GTTCATGAAGAAGTAGAAGCATCGAAAGGTTGGAGAGAATTACAGGAACGGTGGCGACAGCGGTATTCCGGAACCGGAGCGG - UNI23960 - - UN

I29607 - GAGCTTAAAGGATGTGGGATCAAGGAGGGCAGCCGTGGCAGCAATGGCCCTTGAACCAGCAACAGTGGATGCAGTCATTTCAGCACCAGCA

AGATCCAA - UNI23960 - GCCAGATTGACTGGGCTGCTTTGGCCCAGGCTTGGATTGCACAAAGAGAAGCCTCAGGACAGCAAAGCATCGTAGAAC

AACCTCCAGGAATGATGCCAAATGGACAGGATATGTCTGCAATGGAGTCTGGTCCAAATAATCATGGGAATTTTCAAGGGGATTCAAATTTTAACAGAAT

GTGGCAACCAG - UNI20909 - AATGGGGAATGCATCAGCAGCCCCCACACCCCCCTCCAGAGCAGCCATGGATGCCACCAGCACCAGGCCCAATGG

ACATTGTTCCTCCTTCTGAAGACAGCAACAGTCAGGACAGTGGGGAGTTTGCCCCTGACAACAGGCATATATTTAACCAGAACAATCACAACTTTGGTGG

ACCACCTGATAACTTTGCAGTGGGGCCGGTGAACCAGTTTGACTATCAG CATGGGGCTGCTTTTGGTCCACCACAAGGTGGATTTCATCCTCCTTATTG

GCAACCAGGACCTCCAGGACCTCCAGCACCTACACAGAACCGAAGAGAGCGGCCACCATCATTCAGGGACCGACAGCGTTCACCTATTGCACTTCCAGTG

AAGCAGGAGCCTCCACAAATTG ATGCAGTAAAACGCAGGACTCTTCCAGCCTGGATTCGTGAAGGCCTTGAGAAGATGGAACGTGAAAAGCAGAAGAAG

TTAGAGAAAGAGAGAATGGAACAGCAGCGTTCACAGTTGTCAAAAAAAGAAAAGAAGGCCACTGAAGATGCGGAAGGAGGGGATGGGCCTCGCTTACCCC

AAAGAAGTAAATTT GATAGTGATGAAGAGGACGAAGATGCTGAAAACCTGGAGGCTGTGAGCAGTGGCAAAGTCACTAGAAGTCCATCTCCAGCTCCCC

AAGAAGAGCACAGTGAACCAGAGATGACGGAAGAGGAGAAGGAGTACCAAATG ATGTTGCTGACAAAGATGCTTCTAACTGAAATTCTCCTGGACGTCA

CAGATGAAGAAATTTATTACGTGGCTAAAGATGCGCATCGGAAAGCAACGAAAGGTACATTGTGGGTGCTCTAGGGTTCATTTTTGTAGGGGAATTTTTA

TTTCATTGATGTTGGATTTTTTTTTTTTTTTTTTGTCCTCTGGATTTCTATCACACATTTAAATCTTTTCTCTTTGCATGTGTTAACTCTTTGGGAAAGC

TTCAGCTCATAGATACCATAGTGGCACCGTAGAAGCACTTGGTTTTCTCTGACCTACCTAATCACAGATAGCATTCATCTTGTGTAATACTCTAAAACAT

GGTATAGAAAATTCCTCATGTTCAATTTATTTCACTTGAGGCTTTTTTTGTTTTTGTTTTTAAAAATAGATGTCTTGTTATTGATCTCTGACTTCTGTAC

ATTTAAGATGTATAACGAATTACAACAGTCCTTCAGAGTTTTCAGTTTTAATTCTTAGGAAGCAGTGACAACAACCTTCCCTTATAATTTTAGTAACACT

TTAAAAACATACAGAAAATAAAAAATTATGTGCCATATCTCAGAGAAAGAAATACAAATATACTTACCAACTTTTTTCCTCATCATGAACCAATTTCAGC

TTACATCAGAATTGTAATTTCAAAGCCAGACATGCTACTGGTTTTCAAATGAATGTTATGTTTTTAATGTTTCTTCTCTCCCCACAAAGCAGCGATAGTA

GTAGATTTAACAATACCGTAGACTCTCATGACTATGAAATCGTGGCTATTTGTGTTAACATGTTGTTCCTGTTGTTGATGTGATACAAAGCTCCTGCAAA

GCAGCTGGCACAGTCCAGTGCACTGGCCTCCCTCACCGGCCTCGGTAAGTGTCCTCGGGGAAAGGGAGGCTCGCTGGCTTGTCTTTCTACTTGTTCTGTG

GGGAAATGCACTGTTCCTGCGTAGTTCATGAACCTTAGAAGTCAGCTTACTCAGTCTCTAAAAGCTTTAGCTAGTGTCTTTGAGTAAACATTCACAGTAG

AATGACTATAAGTGGGATAGCTAATGTAGTTCATTTGGGTGAGTTGAATTGAGGAGTTCCTCATTTATTGTTCCAGTGTGTATATAATATATGATGTATA

ATTAATTGTATGTTATATATTATATACACATAGTTTATACTTAATAGATAATGGTCTACCCCAGTTTAGGTAGTTTCTAAACTCGCTTTTAAGATTATGG

CATATATACATAAGAATTTACCTAGACAGTAATGAATTTGATGATTTACATAAATTGTGTTGGAGCAAATCAAGTTTCAACTTAGAGGAAATGGGTTTAT

CTTACAACAGGAATGTTGTGTTCATAGTTTGCTATTTGCATGCTATTAAGACTAAAGCTTGAGTTTGCCTTTTCCACATCTTCATGTTAATTTGTGTGGA

GCAAGAGAAACGGGTAGAATAAAATGCCCATGTAATTTTGGAATTATACTTTTGAGATCACTTCTGGGTGGGGAGTAACTCGTACCATTTTTATACCAGT

GAATTAACTTGAGAAATATTTTCAGAATCATTCTCAATTTATTACGGTAGTTGAATTGGCTTAACTGTAGTAAGACTTCATTTTTGCCATGTTAAATGCT

TTTGTTGGTTAGTATGGACAATAAAAGCCATTGTTATGATTCCTTCGTTGTGAGAAATATGTAAAGTGGTCCAAGGAATAAGATTTTACTATCACCGTTG

TCTGAGGATTCTGAAACCGTAAACTTTGAAGTTCTGTCCTCCCCACCCTGAATGCGCATATTCTTCCGGGAAAAGGCAATG
Translation
 - UNI23960 - - UNI29607 - MWDQGGQPWQQWPLNQQQWMQSFQHQQDPS - UNI23960 - SQIDWAALAQAWIAQREASGQQSIVEQPP

GMMPNGQDMSAMESGPNNHGNFQGDSNFNRMWQPE - UNI20909 - EWGMHQQPPHPPPEQPWMPPAPGPMDIVPPSEDSNSQDSGEFAPDNRHIFN

QNNHNFGGPPDNFAVGPVNQFDYQ HGAAFGPPQGGFHPPYWQPGPPGPPAPTQNRRERPPSFRDRQRSPIALPVKQEPPQID DAVKRRTLPAWIREGL

EKMEREKQKKLEKERMEQQRSQLSKKEKKATEDAEGGDGPRLPQRSKF DSDEEDEDAENLEAVSSGKVTRSPSPAPQEEHSEPEMTEEEKEYQM MLLT

KMLLTEILLDVTDEEIYYVAKDAHRKATKGTLWVL
Transcript ENSMUST00000098238
Sequence
CTTGTTCATGAAGAAGTAGAAGCATCGAAAGGTTGGAGAGAATTACAGGAACGGTGGCGACAGCGGTATTCCGGAACCGGAGCGG - UNI29607 - A

GCTTTCCTCGTGTAAAGTATATCATCATGCAATCTCTGATCTATAAGTTTTGAAAATGTAAAAAGTCTTAGCATTAACTGTGTTTAATTTGTCATAAATA

GGAGCTTAAAGGATGTGGGATCAAGGAGGGCAGCCGTGGCAGCAATGGCCCTTGAACCAGCAACAGTGGATGCAGTCATTTCAGCACCAGCAAGATCCAA

 - UNI23960 - GCCAGATTGACTGGGCTGCTTTGGCCCAGGCTTGGATTGCACAAAGAGAAGCCTCAGGACAGCAAAGCATCGTAGAACAACCTCCA

GGAATGATGCCAAATGGACAGGATATGTCTGCAATGGAGTCTGGTCCAAATAATCATGGGAATTTTCAAGGGGATTCAAATTTTAACAGAATGTGGCAAC

CAG - UNI20909 - AATGGGGAATGCATCAGCAGCCCCCACACCCCCCTCCAGAGCAGCCATGGATGCCACCAGCACCAGGCCCAATGGACATTGTT

CCTCCTTCTGAAGACAGCAACAGTCAGGACAGTGGGGAGTTTGCCCCTGACAACAGGCATATATTTAACCAGAACAATCACAACTTTGGTGGACCACCTG

ATAACTTTGCAGTGGGGCCGGTGAACCAGTTTGACTATCAG CATGGGGCTGCTTTTGGTCCACCACAAGGTGGATTTCATCCTCCTTATTGGCAACCAG

GACCTCCAGGACCTCCAGCACCTACACAGAACCGAAGAGAGCGGCCACCATCATTCAGGGACCGACAGCGTTCACCTATTGCACTTCCAGTGAAGCAGGA

GCCTCCACAAATTG ATGCAGTAAAACGCAGGACTCTTCCAGCCTGGATTCGTGAAGGCCTTGAGAAGATGGAACGTGAAAAGCAGAAGAAGTTAGAGAA

AGAGAGAATGGAACAGCAGCGTTCACAGTTGTCAAAAAAAGAAAAGAAGGCCACTGAAGATGCGGAAGGAGGGGATGGGCCTCGCTTACCCCAAAGAAGT

AAATTT GATAGTGATGAAGAGGACGAAGATGCTGAAAACCTGGAGGCTGTGAGCAGTGGCAAAGTCACTAGAAGTCCATCTCCAGCTCCCCAAGAAGAG

CACAGTGAACCAGAGATGACGGAAGAGGAGAAGGAGTACCAAATG ATGTTGCTGACAAAGATGCTTCTAACTGAAATTCTCCTGGACGTCACAGATGAA

GAAATTTATTACGTGGCTAAAGATGCGCATCGGAAAGCAACGAAAG CTCCTGCAAAGCAGCTGGCACAGTCCAGTGCACTGGCCTCCCTCACCGGCCTC

G GCGGACTGGGTGGCTATGGATCAGGCGACAGTGAAGATGAGAGGAGTGACAGAGGTTCTGAGTCATCTGACACTGATGATGAAGAGTTACGGCACCGA

ATCCGGCAAAAACAAGAAGCTTTTTGGAGAAAAGAGAAAGAACAGCAGCTGTTACAAGATAAACAGATAGAAG AAGAAAAGCAGCAAACAGAAAGGGTT

ACAAAAGAGATGAATGAATTTATTCACAGAGAGCAAAATAGTTTATCACTTCTAGAAGCAAGTGAAGCCGACCGTGATGCGGTCAATGACAAGAAAAGAA

CTCCAAACGAAGCTCCGTCAGTGTTAGAGCCCAAAAGAGAGCATAAAGGGAAGGAGAAGGAGCGGGGGAGTAGGTCAGGCAGCTCCAGTAGCGGCAGCTC

CAGTAGCGGCAGCAGGACGAGCAGCAGTAGCAGCTCCGTCTCCAGTTCTTCCTACAGCTCCAGCTCAGGCAGCAGCTGCACGTCCTCTCGCTCCTCATCT

CCTAAGCGGAGAAAGAGACCCAGTAGGAGCAGGTCTCCCCCAGCGAAAGCTAGACGCAGCAGGAGCAGGAGCTACTCGCGCAGAGTGAAAGTAGACAGCA

GCAGGACCAGGGGGAAGCTGAGAGATAGGCGGAGATCTAATAGAAGTAGCATTGAAAGAGAAAGACGAAGAAACCGGAGCCCTTCCAGAGACAGACGTAG

AAGCAGAAGTCGCTCAAGGGATAGACGAACCAATCGTTCCAGTCGCAGTAGGAGTCGAGATAGGCGTAAAATTGAGGATCCACGTGGAAATCTTAGTGGG

AACAGTCATAAGCATAAAGGTGAGGCTAAAGAACAAGACAGGAAAAAGGAGAGGAGTCGAAGTGTAGATAAAGACAGGAGAAAGAAAGACAAGGAAAGGG

ACCGTGAACTGGATAAAAGAAAAGAAAAACAGAAAAGGGAAGAAAAAGATTTTAAATTCAGTAGTCAGGATGATCGGTTAAAAAGGAAGCGAGAAAGTGA

GAGAACTTTCTGTAGGAGTGGTTCTATATCTGTTAAAGTCATAAGACATGACTCTAGACAGGATAGTAAGAAAAATGCTACCAAAGATAGTAAAAGGCAT

TCAGGTTCTGATTCTAGTGGAAGGAGCAGTTCCGAATCCCCCGGAAGTAGCAAAGAAAAGAAGGCTAAGAAGCCTAAACATAGTCGATCGCGCTCCCTGG

AGAAATCTCAAAGGTCTGGTAAGAAGGCAAGCCGCAAACACAAGTCTAAGTCCCGATCAAGGTAGTATACTTTTTAAAGTATTTTGTCTGATTTTTTTTT

TAAGTTTTTTGAATTTATTCAAAGTTGAAAGTGTCCTTTCTCTCTCTCTCTCTCTCTTTTATAAACTCAGTTTGGTATTTATTAAATATTTTTAAATAAT

GTTAGAAATCCTGTATAAAAGTATTTATTTATATTGCAGATTTTAAGTATAAATACATTTTTATTTTTAAATTTTGTCTTTTCCCTTTTTTTTTCTTTCA

GATCAACAACCCCTCCCCGTCGTAAGCGCTGAGGAATGATGTGGCAAGAATGCCATGATGCTGTTTTTAAAAATTCCATGAGTTTAAGGGCTTGTCTCAT

TATAGAGGCACATTGTGGCTGTGTAGGTGAAACCAGATTTTTTTTTTTTATTGTGTAAATAGGTGTCTTTTTTCCAAATGCTGCTCCAAGTTACTTAATA

GGATTTCTTTGTATTACATTTTTTTTCAAGAAATAGTACTTAATAAGACTATAAATATGCCATTTCTCTTTCAGCTGTAATGTTCTCAAAATATTCTTGA

ATGTACTGTGATGTCAATAAAACTATTTAGTTCATTTTTGTTAAACTCTTGCACCTTAATTTTATGATTTTAATCTAAGGAACGTACTTTTATAAAAAGG

CAGCTGAAGTTTTGTATAACAGGTTTTTAAAGTTACTCCCATCTTCTCCAAGAATAGTTTGTCAAAGTTTGTAAATTGTGCCCATGGACTTTTGTCAAAT

TCCAATTTTAAGGGTTCGGGAAAGGGCCAGAAAATGACCTTACTTTTCTTTGAAGCCATCTGATCAGCTTTCTAACCTTTTTTGGGGGGGAGGGGAGGCA

TTCAAGTAATATATTCTCTGTATGAAATGTTATTCACGCCTGTAAAATGAAATTGCTGGAAACAATCAGGCCATTACACCAGTAGAGTTATTTGTAATGA

CTATTTGACACTAATAGTCTGGAACTATATAGTCACTCCTGTTCTACATGCCTAACACCTTGGGGTTACCCGTTAAGAAATAGGATGTAGGATTCAATAT

ATTTTAAAAATATAATATGACCTCAGCTTAATGGTGGAATATTGTGTTATGCAGGATTGTGTCAATTGCATAACATTAAAATGGTCTGATTTTCTCAGTT

TCCAAAACCCATGGCTAGTGAACGGTCTAGCGTGAGTCCCCGCTTGATGAGTAGTAGGCATTTCGCCAAGTGTTCAGCTGCTTCAGGTCTGAGTTTTTAA

GACGATACACTTACACATTGATAGTTGATCTCTGGAAACAGTGCTTTTCATATTGTAACTGAAAGAGAAGCACAGTGCAGAACACAGAAGGCAGAGTATT

ATGCTTTCTTACCAGCAATAGTTCATTTGAAAATAATGCCAGGTTTTTGCCAAGATCAGTGTTTCCTTGAAATGAAGACAGAAATAGATTTGTTTGTGCA

TTCTTGTACCTCGACATAGCATCTTAATTTTGAGCAGTTACGCATTTATCTAAAGGAAATAAATCTGTGAATAAATGCATGTTTACCAAAATGGCTGTTT

ACAGTGCATTTAGTTACAATATTTATAAAGTTGCCATTTCACAGAATAAGTAGTTTGGAGTTCTATACAATTTAGTCATCAGTAATATCTGGAGACAAAA

TGTGCAATATTTTTTATGTAGGTGAGCTAACACAGTGTATCTAATTGAAGAATTCTGATTAATTTGTAATAGATAAGTTGTATAAAATTTTCATACCTTA

AAGTGTTTTAGATTACTCTTCAAGTGAAGTATTATTTTCAAAATAAAATTCTACTG
Translation
 - UNI29607 - MWDQGGQPWQQWPLNQQQWMQSFQHQQDPS - UNI23960 - SQIDWAALAQAWIAQREASGQQSIVEQPPGMMPNGQDMSAME

SGPNNHGNFQGDSNFNRMWQPE - UNI20909 - EWGMHQQPPHPPPEQPWMPPAPGPMDIVPPSEDSNSQDSGEFAPDNRHIFNQNNHNFGGPPDNF

AVGPVNQFDYQ HGAAFGPPQGGFHPPYWQPGPPGPPAPTQNRRERPPSFRDRQRSPIALPVKQEPPQID DAVKRRTLPAWIREGLEKMEREKQKKLEK

ERMEQQRSQLSKKEKKATEDAEGGDGPRLPQRSKF DSDEEDEDAENLEAVSSGKVTRSPSPAPQEEHSEPEMTEEEKEYQM MLLTKMLLTEILLDVTD

EEIYYVAKDAHRKATKA APAKQLAQSSALASLTGLG GGLGGYGSGDSEDERSDRGSESSDTDDEELRHRIRQKQEAFWRKEKEQQLLQDKQIEE EEK

QQTERVTKEMNEFIHREQNSLSLLEASEADRDAVNDKKRTPNEAPSVLEPKREHKGKEKERGSRSGSSSSGSSSSGSRTSSSSSSVSSSSYSSSSGSSCT

SSRSSSPKRRKRPSRSRSPPAKARRSRSRSYSRRVKVDSSRTRGKLRDRRRSNRSSIERERRRNRSPSRDRRRSRSRSRDRRTNRSSRSRSRDRRKIEDP

RGNLSGNSHKHKGEAKEQDRKKERSRSVDKDRRKKDKERDRELDKRKEKQKREEKDFKFSSQDDRLKRKRESERTFCRSGSISVKVIRHDSRQDSKKNAT

KDSKRHSGSDSSGRSSSESPGSSKEKKAKKPKHSRSRSLEKSQRSGKKASRKHKSKSRSR
Transcript ENSMUST00000029911
Sequence
ATCTTGTCTTGTTCATGAAGAAGTAGAAGCATCGAAAGGTTGGAGAGAATTACAGGAACGGTGGCGACAGCGGTATTCCGGAACCGGAGCGG - UNI23

960 - - UNI29607 - GAGCTTAAAGGATGTGGGATCAAGGAGGGCAGCCGTGGCAGCAATGGCCCTTGAACCAGCAACAGTGGATGCAGTCATTTC

AGCACCAGCAAGATCCAA - UNI23960 - GCCAGATTGACTGGGCTGCTTTGGCCCAGGCTTGGATTGCACAAAGAGAAGCCTCAGGACAGCAAAGC

ATCGTAGAACAACCTCCAGGAATGATGCCAAATGGACAGGATATGTCTGCAATGGAGTCTGGTCCAAATAATCATGGGAATTTTCAAGGGGATTCAAATT

TTAACAGAATGTGGCAACCAG - UNI20909 - AATGGGGAATGCATCAGCAGCCCCCACACCCCCCTCCAGAGCAGCCATGGATGCCACCAGCACCA

GGCCCAATGGACATTGTTCCTCCTTCTGAAGACAGCAACAGTCAGGACAGTGGGGAGTTTGCCCCTGACAACAGGCATATATTTAACCAGAACAATCACA

ACTTTGGTGGACCACCTGATAACTTTGCAGTGGGGCCGGTGAACCAGTTTGACTATCAG CATGGGGCTGCTTTTGGTCCACCACAAGGTGGATTTCATC

CTCCTTATTGGCAACCAGGACCTCCAGGACCTCCAGCACCTACACAGAACCGAAGAGAGCGGCCACCATCATTCAGGGACCGACAGCGTTCACCTATTGC

ACTTCCAGTGAAGCAGGAGCCTCCACAAATTG ATGCAGTAAAACGCAGGACTCTTCCAGCCTGGATTCGTGAAGGCCTTGAGAAGATGGAACGTGAAAA

GCAGAAGAAGTTAGAGAAAGAGAGAATGGAACAGCAGCGTTCACAGTTGTCAAAAAAAGAAAAGAAGGCCACTGAAGATGCGGAAGGAGGGGATGGGCCT

CGCTTACCCCAAAGAAGTAAATTT GATAGTGATGAAGAGGACGAAGATGCTGAAAACCTGGAGGCTGTGAGCAGTGGCAAAGTCACTAGAAGTCCATCT

CCAGCTCCCCAAGAAGAGCACAGTGAACCAGAGATGACGGAAGAGGAGAAGGAGTACCAAATG ATGTTGCTGACAAAGATGCTTCTAACTGAAATTCTC

CTGGACGTCACAGATGAAGAAATTTATTACGTGGCTAAAGATGCGCATCGGAAAGCAACGAAAG CTCCTGCAAAGCAGCTGGCACAGTCCAGTGCACTG

GCCTCCCTCACCGGCCTCG GCGGACTGGGTGGCTATGGATCAGGCGACAGTGAAGATGAGAGGAGTGACAGAGGTTCTGAGTCATCTGACACTGATGAT

GAAGAGTTACGGCACCGAATCCGGCAAAAACAAGAAGCTTTTTGGAGAAAAGAGAAAGAACAGCAGCTGTTACAAGATAAACAGATAGAAG AAGAAAAG

CAGCAAACAGAAAGGGTTACAAAAGAGATGAATGAATTTATTCACAGAGAGCAAAATAGTTTATCACTTCTAGAAGCAAGTGAAGCCGACCGTGATGCGG

TCAATGACAAGAAAAGAACTCCAAACGAAGCTCCGTCAGTGTTAGAGCCCAAAAGAGAGCATAAAGGGAAGGAGAAGGAGCGGGGGAGTAGGTCAGGCAG

CTCCAGTAGCGGCAGCTCCAGTAGCGGCAGCAGGACGAGCAGCAGTAGCAGCTCCGTCTCCAGTTCTTCCTACAGCTCCAGCTCAGGCAGCAGCTGCACG

TCCTCTCGCTCCTCATCTCCTAAGCGGAGAAAGAGACCCAGTAGGAGCAGGTCTCCCCCAGCGAAAGCTAGACGCAGCAGGAGCAGGAGCTACTCGCGCA

GAGTGAAAGTAGACAGCAGCAGGACCAGGGGGAAGCTGAGAGATAGGCGGAGATCTAATAGAAGTAGCATTGAAAGAGAAAGACGAAGAAACCGGAGCCC

TTCCAGAGACAGACGTAGAAGCAGAAGTCGCTCAAGGGATAGACGAACCAATCGTTCCAGTCGCAGTAGGAGTCGAGATAGGCGTAAAATTGAGGATCCA

CGTGGAAATCTTAGTGGGAACAGTCATAAGCATAAAGGTGAGGCTAAAGAACAAGACAGGAAAAAGGAGAGGAGTCGAAGTGTAGATAAAGACAGGAGAA

AGAAAGACAAGGAAAGGGACCGTGAACTGGATAAAAGAAAAGAAAAACAGAAAAGGGAAGAAAAAGATTTTAAATTCAGTAGTCAGGATGATCGGTTAAA

AAGGAAGCGAGAAAGTGAGAGAACTTTCTGTAGGAGTGGTTCTATATCTGTTAAAGTCATAAGACATGACTCTAGACAGGATAGTAAGAAAAATGCTACC

AAAGATAGTAAAAGGCATTCAGGTTCTGATTCTAGTGGAAGGAGCAGTTCCGAATCCCCCGGAAGTAGCAAAGAAAAGAAGGCTAAGAAGCCTAAACATA

GTCGATCGCGCTCCCTGGAGAAATCTCAAAGGTCTGGTAAGAAGGCAAGCCGCAAACACAAGTCTAAGTCCCGATCAAG ATCAACAACCCCTCCCCGTC

GTAAGCGCTGAGGAATGATGTGGCAAGAATGCCATGATGCTGTTTTTAAAAATTCCATGAGTTTAAGGGCTTGTCTCATTATAGAGGCACATTGTGGCTG

TGTAGGTGAAACCAGATTTTTTTTTTTTATTGTGTAAATAGGTGTCTTTTTTCCAAATGCTGCTCCAAGTTACTTAATAGGATTTCTTTGTATTACATTT

TTTTTCAAGAAATAGTACTTAATAAGACTATAAATATGCCATTTCTCTTTCAGCTGTAATGTTCTCAAAATATTCTTGAATGTACTGTGATGTCAATAAA

ACTATTTAGTTCATTTTTGTTAAACTCTTGCACCTTAATTTTATGATTTTAATCTAAGGAACGTACTTTTATAAAAAGGCAGCTGAAGTTTTGTATAACA

GGTTTTTAAAGTTACTCCCATCTTCTCCAAGAATAGTTTGTCAAAGTTTGTAAATTGTGCCCATGGACTTTTGTCAAATTCCAATTTTAAGGGTTCGGGA

AAGGGCCAGAAAATGACCTTACTTTTCTTTGAAGCCATCTGATCAGCTTTCTAACCTTTTTTGGGGGGGAGGGGAGGCATTCAAGTAATATATTCTCTGT

ATGAAATGTTATTCACGCCTGTAAAATGAAATTGCTGGAAACAATCAGGCCATTACACCAGTAGAGTTATTTGTAATGACTATTTGACACTAATAGTCTG

GAACTATATAGTCACTCCTGTTCTACATGCCTAACACCTTGGGGTTACCCGTTAAGAAATAGGATGTAGGATTCAATATATTTTAAAAATATAATATGAC

CTCAGCTTAATGGTGGAATATTGTGTTATGCAGGATTGTGTCAATTGCATAACATTAAAATGGTCTGATTTTCTCAGTTTCCAAAACCCATGGCTAGTGA

ACGGTCTAGCGTGAGTCCCCGCTTGATGAGTAGTAGGCATTTCGCCAAGTGTTCAGCTGCTTCAGGTCTGAGTTTTTAAGACGATACACTTACACATTGA

TAGTTGATCTCTGGAAACAGTGCTTTTCATATTGTAACTGAAAGAGAAGCACAGTGCAGAACACAGAAGGCAGAGTATTATGCTTTCTTACCAGCAATAG

TTCATTTGAAAATAATGCCAGGTTTTTGCCAAGATCAGTGTTTCCTTGAAATGAAGACAGAAATAGATTTGTTTGTGCATTCTTGTACCTCGACATAGCA

TCTTAATTTTGAGCAGTTACGCATTTATCTAAAGGAAATAAATCTGTGAATAAATGCATGTTTACCAAAATGGCTGTTTACAGTGCATTTAGTTACAATA

TTTATAAAGTTGCCATTTCACAGAATAAGTAGTTTGGAGTTCTATACAATTTAGTCATCAGTAATATCTGGAGACAAAATGTGCAATATTTTTTATGTAG

GTGAGCTAACACAGTGTATCTAATTGAAGAATTCTGATTAATTTGTAATAGATAAGTTGTATAAAATTTTCATACCTTAAAGTGTTTTAGATTACTCTTC

AAGTGAAGTATTATTTTCAAAATAAAATTCTACTG
Translation
 - UNI23960 - - UNI29607 - MWDQGGQPWQQWPLNQQQWMQSFQHQQDPS - UNI23960 - SQIDWAALAQAWIAQREASGQQSIVEQPP

GMMPNGQDMSAMESGPNNHGNFQGDSNFNRMWQPE - UNI20909 - EWGMHQQPPHPPPEQPWMPPAPGPMDIVPPSEDSNSQDSGEFAPDNRHIFN

QNNHNFGGPPDNFAVGPVNQFDYQ HGAAFGPPQGGFHPPYWQPGPPGPPAPTQNRRERPPSFRDRQRSPIALPVKQEPPQID DAVKRRTLPAWIREGL

EKMEREKQKKLEKERMEQQRSQLSKKEKKATEDAEGGDGPRLPQRSKF DSDEEDEDAENLEAVSSGKVTRSPSPAPQEEHSEPEMTEEEKEYQM MLLT

KMLLTEILLDVTDEEIYYVAKDAHRKATKA APAKQLAQSSALASLTGLG GGLGGYGSGDSEDERSDRGSESSDTDDEELRHRIRQKQEAFWRKEKEQQ

LLQDKQIEE EEKQQTERVTKEMNEFIHREQNSLSLLEASEADRDAVNDKKRTPNEAPSVLEPKREHKGKEKERGSRSGSSSSGSSSSGSRTSSSSSSVS

SSSYSSSSGSSCTSSRSSSPKRRKRPSRSRSPPAKARRSRSRSYSRRVKVDSSRTRGKLRDRRRSNRSSIERERRRNRSPSRDRRRSRSRSRDRRTNRSS

RSRSRDRRKIEDPRGNLSGNSHKHKGEAKEQDRKKERSRSVDKDRRKKDKERDRELDKRKEKQKREEKDFKFSSQDDRLKRKRESERTFCRSGSISVKVI

RHDSRQDSKKNATKDSKRHSGSDSSGRSSSESPGSSKEKKAKKPKHSRSRSLEKSQRSGKKASRKHKSKSRSR RSTTPPRRKR

For any suggestions or comments, please send an email to unitrap@crg.es