Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028273 (Pdlim5)
Chromosomal location
Chr 3: 141904328 - 142058599 (-)
Description
PDZ and LIM domain 5 Gene [Source:MGI Symbol;Acc:MGI:1927489]
RefSeq_dna
NM_019809 NM_022554 NM_019808 
RefSeq_peptide
NP_062783.2 NP_072048.2 NP_062782.2 
UniGene
Mm.117709 Mm.413081 
MGI
MGI:1927489 
Uniprot/SWISSPROT
Q8CI51 
Uniprot/SPTREMBL
Q9CRA2 Q2Q7P0 Q3UGD0 Q8VDV4 
Human Ortholog
ENSG00000163110 (PDLIM5)
Omim not available
UniTrap UNI11607
Vector Insertion
Chr 3: 142058549 - 142058583
Public Clones P025B05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36889
Vector Insertion
Chr 3: 142054676 - 142058583
Public Clones 5SE305H06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7107
Vector Insertion
Chr 3: 142015850 - 142054676
Public Clones RRJ374 (baygenomics) RRO340 (baygenomics) IST14857F10 (tigm) IST11563E2 (tigm)
Private Clones OST352416 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8964
Vector Insertion
Chr 3: 141977413 - 142015697
Public Clones (sanger) RRE276 (baygenomics) IST13832A11 (tigm)
Private Clones OST66127 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6648
Vector Insertion
Chr 3: 141966944 - 141967260
Public Clones RHA295 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1282
Vector Insertion
Chr 3: 141922257 - 141940780
Public Clones DD0421 (sanger) CSH674 (baygenomics) XH199 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090134
Sequence
CACTTGTCAGCGCTGGTCTGAGGCGGAGGGTGCGCCGCGCCGGTCAGGAG - UNI11607 - TTTCTTTCATTTTCTAGAACTGCACGTTGAACCCTG

GGAACCATGAGCAACTACAGTGTGTCATTGGTCGGCCCAGCTCCTTGGGGTTTCCGGCTCCAAGGTGGCAAGGATTTCAACATGCCTCTGACAATCTCTA

GT - UNI7107 - CTGAAGGATGGTGGCAAGGCATCTCAGGCACATGTCAGAATAGGGGACGTGGTTCTCAGCATCGATGGGATCAGTGCACAGGGAA

TGACGCATCTTGAAGCCCAGAACAAGATTAAGGCTTGTACGGGCTCCTTGAATATGACTCTACAAAG - UNI8964 - AGCTTCAGCTGCAGCCAAGA

GTGAGCCGGTTTCCGTCCAGAAG AAAACACACGTGACAAA TAACCCTGGCACTGT GAAAATTCCACCTAAACG CCCACCAAGAAAACACATTGTGG

AGCGCAACACGGAGTTTTATCACATACCCACTCACAGTGATGCCAGCAAGAAACGGCTGATTGAGGACACTGAGGACTGGCGCCCCCGGACTGGAACGAC

TCAGTCTCGTTCTTTCCGGATCCTTGCCCAGATCACTGGGACTGAGCATC - UNI6648 - TGACAGAATCTGAAAATGACAATACGAAGAAGGCAAA

 GGAAAAGATACCCCTTCACGTCTTTAGTCCCAAATACACAAAATTACGTGACTGGCACCATGAAGTTTCAGCACGTGCTCTTAATGTACAGTGA
Translation
 - UNI11607 - MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISS - UNI7107 - LKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKAC

TGSLNMTLQR - UNI8964 - RASAAAKSEPVSVQK KTHVTN NNPGTV VKIPPKR RPPRKHIVERNTEFYHIPTHSDASKKRLIEDTEDWRPRT

GTTQSRSFRILAQITGTEHL - UNI6648 - LTESENDNTKKAK KEKIPLHVFSPKYTKLRDWHHEVSARALNVQ
Transcript ENSMUST00000084039
Sequence
CTGAGGCGGAGGGTGCGCCGCGCCGGTCAGGAG - UNI11607 - TTTCTTTCATTTTCTAGAACTGCACGTTGAACCCTGGGAACCATGAGCAACTA

CAGTGTGTCATTGGTCGGCCCAGCTCCTTGGGGTTTCCGGCTCCAAGGTGGCAAGGATTTCAACATGCCTCTGACAATCTCTAGT - UNI7107 - CT

GAAGGATGGTGGCAAGGCATCTCAGGCACATGTCAGAATAGGGGACGTGGTTCTCAGCATCGATGGGATCAGTGCACAGGGAATGACGCATCTTGAAGCC

CAGAACAAGATTAAGGCTTGTACGGGCTCCTTGAATATGACTCTACAAAG - UNI8964 - AGCTTCAGCTGCAGCCAAGAGTGAGCCGGTTTCCGTC

CAGAAG GGTGAACCTAAGGAAGTAGTTAAGCCTGTGCCCATTACATCTCCTGCTGTATCCAAAGTCACTTCCACTACCAACATGGCCTACAATAAAGCA

CCACGGCCCTTTGGTTCTGTGTCTTCACCAAAAGTCACATCCATCCCATCACCATCGTCTGCGTTCACCCCAGCCCATGCCGCCACTTCATCACATGCTT

CCCCCACACCTGTGGCCGCTGCCACTCCCCTCCACCTCTCTGCATCCGGACTGCATGTTAGTGCCAATCTTAGTGCTGACCAGTGTTCATCTCCACCGAA

CACTGGTAAACCTGCAGTTAATGTCCCACGGCAGCCCACAGTCACCAGCGTGTGTTCCGAGTCTGCTCAGGAGCTAGCAGAGGGACAGAGAAGAGGATCC

CAGGGTGACATTAAGCAGCAAAATGG CCCACCAAGAAAACACATTGTGGAGCGCAACACGGAGTTTTATCACATACCCACTCACAGTGATGCCAGCAAG

AAACGGCTGATTGAGGACACTGAGGACTGGCGCCCCCGGACTGGAACGACTCAGTCTCGTTCTTTCCGGATCCTTGCCCAGATCACTGGGACTGAGCATC

 - UNI6648 - TGACAGAATCTGAAAATGACAATACGAAGAAGGCAAA GGAAAAGATACCCCTTCACGTCTTTAGTCCCAAATACACAAAATTACGT

GACTGGCACCATGAAGTTTCAGCACGTGCTCTTAATGTACAGTGACTCTGAGCCCTGCTCCCCCACCTAAGCAGCTAGCACATACCTTTCATTCACGTTT

TCTTTCTTCCATCTATAGCAAAATCTGTTTTACATTTGACTCGTGAAAACTA
Translation
 - UNI11607 - MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISS - UNI7107 - LKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKAC

TGSLNMTLQR - UNI8964 - RASAAAKSEPVSVQK GEPKEVVKPVPITSPAVSKVTSTTNMAYNKAPRPFGSVSSPKVTSIPSPSSAFTPAHAATS

SHASPTPVAAATPLHLSASGLHVSANLSADQCSSPPNTGKPAVNVPRQPTVTSVCSESAQELAEGQRRGSQGDIKQQNG GPPRKHIVERNTEFYHIPTH

SDASKKRLIEDTEDWRPRTGTTQSRSFRILAQITGTEHL - UNI6648 - LTESENDNTKKAK KEKIPLHVFSPKYTKLRDWHHEVSARALNVQ
Transcript ENSMUST00000058626
Sequence
GTTTCTTTCATTTTCTAGAACTGCACGTTGAACCCTGGGAACCATGAGCAACTACAGTGTGTCATTGGTCGGCCCAGCTCCTTGGGGTTTCCGGCTCCAA

GGTGGCAAGGATTTCAACATGCCTCTGACAATCTCTAGT - UNI7107 - CTGAAGGATGGTGGCAAGGCATCTCAGGCACATGTCAGAATAGGGGAC

GTGGTTCTCAGCATCGATGGGATCAGTGCACAGGGAATGACGCATCTTGAAGCCCAGAACAAGATTAAGGCTTGTACGGGCTCCTTGAATATGACTCTAC

AAAG - UNI8964 - AGCTTCAGCTGCAGCCAAGAGTGAGCCGGTTTCCGTCCAGAAG CCCACAGTCACCAGCGTGTGTTCCGAGTCTGCTCAGGAG

CTAGCAGAGGGACAGAGAAGAGGATCCCAGGGTGACATTAAGCAGCAAAATGG TAACCCTGGCACTGT GAAAATTCCACCTAAACG CCCACCAAGAA

AACACATTGTGGAGCGCAACACGGAGTTTTATCACATACCCACTCACAGTGATGCCAGCAAGAAACGGCTGATTGAGGACACTGAGGACTGGCGCCCCCG

GACTGGAACGACTCAGTCTCGTTCTTTCCGGATCCTTGCCCAGATCACTGGGACTGAGCATC - UNI6648 - TGACAGAATCTGAAAATGACAATAC

GAAGAAGGCAAA GGAAAAGATACCCCTTCACGTCTTTAGTCCCAAATACACAAAATTACGTGACTGGCACCATGAAGTTTCAGCACGTGCTCTTAATGT

ACAGTGACTCTGAGCCCTGCTCCCCCACCTAAGCAGCTAGCACATACCTTTCATTCACGTTTTCTTTCTTCCATCTATAGCAAAATCTGTTTTACATTTG

ACTCGTGAAAACTAGAACAATTGGTGTGCTTTCCTAACAATTTCCGGTTGTGAACACGAGAAGACTGAACACGTTGTATCCTAATTGGTAGCTCACAAAT

GCAAAGCCAAAGGATGGAAAGGAAATGACCTGACCCCTTCAATGTATTTACATCTATTCTCACTGCTTCAGTCATG
Translation
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISS - UNI7107 - LKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQR - U

NI8964 - RASAAAKSEPVSVQK PTVTSVCSESAQELAEGQRRGSQGDIKQQNG GNPGTV VKIPPKR RPPRKHIVERNTEFYHIPTHSDASKKRL

IEDTEDWRPRTGTTQSRSFRILAQITGTEHL - UNI6648 - LTESENDNTKKAK KEKIPLHVFSPKYTKLRDWHHEVSARALNVQ
Transcript ENSMUST00000029941
Sequence
CACTTGTCAGCGCTGGTCTGAGGCGGAGGGTGCGCCGCGCCGGTCAGGAG - UNI11607 - TTTCTTTCATTTTCTAGAACTGCACGTTGAACCCTG

GGAACCATGAGCAACTACAGTGTGTCATTGGTCGGCCCAGCTCCTTGGGGTTTCCGGCTCCAAGGTGGCAAGGATTTCAACATGCCTCTGACAATCTCTA

GT - UNI7107 - CTGAAGGATGGTGGCAAGGCATCTCAGGCACATGTCAGAATAGGGGACGTGGTTCTCAGCATCGATGGGATCAGTGCACAGGGAA

TGACGCATCTTGAAGCCCAGAACAAGATTAAGGCTTGTACGGGCTCCTTGAATATGACTCTACAAAG - UNI8964 - AGCTTCAGCTGCAGCCAAGA

GTGAGCCGGTTTCCGTCCAGAAG GGTGAACCTAAGGAAGTAGTTAAGCCTGTGCCCATTACATCTCCTGCTGTATCCAAAGTCACTTCCACTACCAACA

TGGCCTACAATAAAGCACCACGGCCCTTTGGTTCTGTGTCTTCACCAAAAGTCACATCCATCCCATCACCATCGTCTGCGTTCACCCCAGCCCATGCCGC

CACTTCATCACATGCTTCCCCCACACCTGTGGCCGCTGCCACTCCCCTCCACCTCTCTGCATCCGGACTGCATGTTAGTGCCAATCTTAGTGCTGACCAG

TGTTCATCTCCACCGAACACTGGTAAACCTGCAGTTAATGTCCCACGGCAGCCCACAGTCACCAGCGTGTGTTCCGAGTCTGCTCAGGAGCTAGCAGAGG

GACAGAGAAGAGGATCCCAGGGTGACATTAAGCAGCAAAATGG CCCACCAAGAAAACACATTGTGGAGCGCAACACGGAGTTTTATCACATACCCACTC

ACAGTGATGCCAGCAAGAAACGGCTGATTGAGGACACTGAGGACTGGCGCCCCCGGACTGGAACGACTCAGTCTCGTTCTTTCCGGATCCTTGCCCAGAT

CACTGGGACTGAGCATC - UNI6648 - TGACAGAATCTGAAAATGACAATACGAAGAAGGCAAA TAGCACCCAGGAGCCTTCTCAGCAACCGGCGT

CATCTGGAGCTTCACCTCTGAGCGCGTCTGAGGGCCCCGAGAGCCCAGGTTCCAGCAGGCCCTCGGTGGCTGGCCTCCGCTCCGCTGCTGCTTTCAAGCC

TGTAGGATCCACCAGCGTCAAGTCACCTAGCTGGCAGCGTCCAAACCAAGCAG - UNI1282 - CACCTTCTACTGGGAGAATTTCAAACAATGCACG

TTCTTCAGGTACAGGGGCGTCTGTGGGGCCTCCCCAGCCAAGTGACCAAGACACACTTGTGCAGAGAGCGGAACACATTCCAGCGGGCAAGCGGACCCCC

ATGTGTGCCCACTGCAACCAAGTTATCAG GGGACCTTTTCTTGTGGCTCTGGGGAAGTCCTGGCATCCAGAAGAATTTAACTGTGCTCATTGCAAAAAC

ACAATGGCCTACATAGGCTTTGTAGAGGAGAAGGGAGCACTGTACTGTGAGCTATGCTATGAGAAGTTCTTTGCTCCTGAATGTGGCCGGTGCCAAAGGA

AGATCCTTGGA GAAGTCATCAATGCTTTGAAGCAGACCTGGCATGTGTCCTGTTTTGTGTGTGTGGCCTGTGGAAAACCCATTCGTAATAATGTTTTCC

ACTTGGAAGATGGCGAGCCCTACTGTGAGACAG ACTACTACGCCCTTTTTGGAACAATATGTCGTGGATGTGAATTCCCCATAGAGGCTGGTGACATGT

TCCTGGAAGCTCTGGGATACACTTGGCATGATACTTGCTTTGTGTGCTCT GTGTGTTGTGAAAGTTTGGAAGGGCAGACATTTTTCTCCAAGAAGGACA

AGCCACTTTGCAAAAAACATGCTCATTCTGTGAATTTTTGAAAATCAGTGGTTCCAGGAAAGAGAAGAAATTTGAAGAAAAAGCAAAATCAAAATTACCA

TTTAATTTTTAGTTTAATATTTATATGGAGTTCTCAAATAGTAATAGCCCTGAAGGCACAGACTCCAACTTTAAAAATCAAATCTGAGAAAACGTTTGGT

TTAGAAAGCCACAGACAGTTTGGCATTTGTTATGAATTGCCAGTATTTTCTGCACATGAAATAGCTTTTATAAAAATCAATTTCCTGGCTATTAAGTTCA

TCTTAGAATAAATTAGCAAAGTATTACATTTTAGAATTAAAATCCCTAGCCTCTATGCTGAAATAATACTTTGTGGGGCGGGTAGTAGCTATGAGAATCC

ACAGAAGGCAATAAAAGTGCCTTAAACCTTATTAATAAGAATAATTGTTTAATAAAACCATTTTATCTTTAAAATAGTAAGTAGAAATCTAAATAAATTT

TATGAGTAGGCAGTAACTTTTCTGTTTAGTGAGTGTACTTGCTTTGCTCTTATCATTGGTCTTACCTTTCAGTAAGATGGGCCATGGAAATTCTTGATCA

AAGTGTGTCGTGCCAGTAAGAGATTGTTGTGATCTCTTCTGATGTTCTCCCAGATGCTGGCCGCCTTCAGATGGGGCAGTTTGTTTGTGTTGTGTATGGC

TGCCTGGTCCAGACCGCCATGCTTTTCATCTCTTATGCTGACATGAAGATATTTCAATAGCGTTAGACTCTAATAGTTTTGTCTCCTTTTTAGAAAAGAG

TAGGTGGAAGATAAAGGAATTATGGAAATAAAGTCATTGTAAGTAGAAAGTTAAAAGGACCACTTCCCACTTTCAGATAATGAACTGACTGATTTTTACA

TCTTATGTCTCTAACTGAAGGTTCAAAACCTCCTTGCCCGGTTCTTGGTTCTTTTTTCTTTTTGGTTCGTTTTAGATTGAGGATTATGATAAGAGCCAAC

TGTATATTGTTACTGTGTTTTTGCTTATTTGGAGTTGTTTGGGGGATTTTGTTTCTTGTTTTTTGTTTGGGATTCTTTTCTATCAGTAAGTAAATCCCCT

CCAGCTGTGTGATCGCTGACTTAGACAACTTTGGGTCTCGGGCCTTTGGTAGTAAGGGAGAACCATGATGCAGCTCTCCCATGCTCCCGTCATCTGTTCG

TCCTGAGAGAGCACAGCATCATGCAGGCACCGCCTGTAGTCAGGAAAGTGACTTTGAGACAGCCGTGTAGTTTGCCTCACTACCTAGGGAGAAAAGAAAT

GATGGCGTTTCGTGTTTTCTTCGTTTCTATAATGAATAAAAGCGTGTGATCCTGCTG
Translation
 - UNI11607 - MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISS - UNI7107 - LKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKAC

TGSLNMTLQR - UNI8964 - RASAAAKSEPVSVQK GEPKEVVKPVPITSPAVSKVTSTTNMAYNKAPRPFGSVSSPKVTSIPSPSSAFTPAHAATS

SHASPTPVAAATPLHLSASGLHVSANLSADQCSSPPNTGKPAVNVPRQPTVTSVCSESAQELAEGQRRGSQGDIKQQNG GPPRKHIVERNTEFYHIPTH

SDASKKRLIEDTEDWRPRTGTTQSRSFRILAQITGTEHL - UNI6648 - LTESENDNTKKAN NSTQEPSQQPASSGASPLSASEGPESPGSSRPSV

AGLRSAAAFKPVGSTSVKSPSWQRPNQAA - UNI1282 - APSTGRISNNARSSGTGASVGPPQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIR RG

PFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILG EVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCET

D DYYALFGTICRGCEFPIEAGDMFLEALGYTWHDTCFVCS VCCESLEGQTFFSKKDKPLCKKHAHSVNF

For any suggestions or comments, please send an email to unitrap@crg.es