Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028295 (1810030N24Rik)
Chromosomal location
Chr 4: 34715913 - 34725672 (-)
Description
RIKEN cDNA 1810030N24 gene Gene [Source:MGI Symbol;Acc:MGI:1913541]
RefSeq_dna
NM_025471 
RefSeq_peptide
NP_079747.1 
MGI
MGI:1913541 
Uniprot/SWISSPROT
Q9CQQ0 
Uniprot/SPTREMBL
A2AT49 
Human Ortholog
ENSG00000111850 (C6orf162)
Omim not available
UniTrap UNI30172
Vector Insertion
Chr 4: 34719122 - 34725520
Public Clones (sanger) D093H01 (ggtc) PST21628-NL (escells) IST14735H10 (tigm) IST14884F11 (tigm)
IST14243A7 (tigm) IST11698B6 (tigm) IST14725G2 (tigm) IST10228D5 (tigm)
IST10281C8 (tigm) IST12588H7 (tigm) IST12897B12 (tigm) IST11575H3 (tigm)
IST12845D3 (tigm) IST11575G11 (tigm) IST10836H10 (tigm) IST10818H1 (tigm)
IST14671E2 (tigm) IST13038A6 (tigm) IST12322F8 (tigm) IST14635B2 (tigm)
IST14681F11 (tigm) IST12064E2 (tigm) IST11541C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16357
Vector Insertion
Chr 4: 34718664 - 34719126
Public Clones not available
Private Clones OST462443 (lexicon) OST460177 (lexicon) OST458641 (lexicon) OST453939 (lexicon)
OST425597 (lexicon) OST422557 (lexicon) OST405380 (lexicon) OST393787 (lexicon)
OST392523 (lexicon) OST388753 (lexicon) OST376034 (lexicon) OST369824 (lexicon)
OST361664 (lexicon) OST356296 (lexicon) OST352834 (lexicon) OST350889 (lexicon)
OST345913 (lexicon) OST340562 (lexicon) OST326393 (lexicon) OST312091 (lexicon)
OST272904 (lexicon) OST271004 (lexicon) OST270310 (lexicon) OST269261 (lexicon)
OST263936 (lexicon) OST256230 (lexicon) OST181434 (lexicon) OST175482 (lexicon)
OST173886 (lexicon) OST156087 (lexicon) OST155992 (lexicon) OST148582 (lexicon)
OST148557 (lexicon) OST146210 (lexicon) OST142983 (lexicon) OST137438 (lexicon)
OST124793 (lexicon) OST120957 (lexicon) OST120931 (lexicon) OST120830 (lexicon)
OST106772 (lexicon) OST105430 (lexicon) OST105228 (lexicon) OST102912 (lexicon)
OST91029 (lexicon) OST90874 (lexicon) OST81686 (lexicon) OST60075 (lexicon)
OST59030 (lexicon) OST57884 (lexicon) OST57521 (lexicon) OST45292 (lexicon)
OST45291 (lexicon) OST37978 (lexicon) OST37606 (lexicon) OST34112 (lexicon)
OST32901 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19751
Vector Insertion
Chr 4: 34715920 - 34716397
Public Clones CMHD-GT_377B10-3 (cmhd) CMHD-GT_467B3-3 (cmhd) CMHD-GT_378B11-3 (cmhd) CMHD-GT_442C12-3 (cmhd)
CMHD-GT_397A5-3 (cmhd) CMHD-GT_378F11-3 (cmhd) PSTVUpb16h1 (vanderbilt) PSTVUpb9b7 (vanderbilt)
Private Clones OST381909 (lexicon) OST258746 (lexicon) OST233271 (lexicon) OST219555 (lexicon)
OST202787 (lexicon) OST180898 (lexicon) OST169100 (lexicon) OST128194 (lexicon)
OST112215 (lexicon) OST108868 (lexicon) OST104665 (lexicon) OST87152 (lexicon)
OST64348 (lexicon) OST64120 (lexicon)
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33186
Vector Insertion
Chr 4: 34715920 - 34718664
Public Clones IST10494H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108132
Sequence
CCGCCAGCCCTCGAAGGGGAGGGTTGTGGTTTGCAGAAGATGCTAGG - UNI30172 - AGTTAACCAGCTTATCCAGAGAGGCTTCTGGCTAATTCA

CCAGACAAAGGAGCAGCAGCAGTAAATCCTTTCACTTCATCCCCTGCTGTTTTATGATGAGGTGCTAAATAGCTTCTGGCCTCTGAGGAACTCAGACTGG

CTGGTCAGCTGCCTCAGCAAAGTCACTTAGACTTAAG - UNI16357 - - UNI30172 - - UNI33186 - GTAATAATCTTCAGTAGCCAAGA

TGTCTTCAGCACCTGATCCTCCAACAGTTAAAAAAGAACCATTAAAAGAGAAAAACTTTGAAAACCCAGGCCTCCGAGGGGCGCACACAACCACCTTATT

TCGAGCTGTGAATCCCGAGCTCTTCATTAAACCC - UNI19751 - - UNI33186 - AACAAACCTGTGATGGCTTTTGGATTGGTAACCCTTTCA

CTTTGTGTGGCTTACATTGGTTATCTGCATGCAACTCAAGAGAACAGAAAGGACCTCTATGAAGCCATTGACAGTGAAGGGCATCGGTACATGAGGAGAA

AAACATCTAAGTGGGACTAACTGCTGCTTCCTTCAGGTGGAGTGTTATTATAGGCTCCGACACCTTTGAAAGAAAGACTGTTAGTGCACAGAATTGTTTC

TTGTTCCATAATATGTTAACAAGGGAGAATATAAAATTGAAAGCAGTCCACTGTGGTGAGTTTAGTCTCATTACAGCTGAAGGCATTAAATTCTGTATAA

TAAAAGTACCCAGTACTCTTCCATTTGCATGGAGTTTCTAACGTTTTAGAGTGGATTGTGCCTTTGCAGCAATGCTTTACTGTTTAGGAGAGAAGACAAC

CCCTTCAGTTACTAAAATCATAATTAAATGAAAGAATAAAACAAA
Translation
 - UNI30172 -  - UNI16357 - - UNI30172 - - UNI33186 - MSSAPDPPTVKKEPLKEKNFENPGLRGAHTTTLFRAVNPELFIKP 

- UNI19751 - - UNI33186 - NKPVMAFGLVTLSLCVAYIGYLHATQENRKDLYEAIDSEGHRYMRRKTSKWD
Transcript ENSMUST00000108131
Sequence
ACGGGACGCCGGAAGTCTCTGAGCCTGGCGGCGTCCGAGCTGAAGCTTCCCCGGCTTCCCAATTGCCCAAG - UNI30172 - AGTTAACCAGCTTAT

CCAGAGAGGCTTCTGGCTAATTCACCAGACAAAGGAGCAGCAGCAGTAAATCCTTTCACTTCATCCCCTGCTGTTTTATGATGAGGTGCTAAATAGCTTC

TGGCCTCTGAGGAACTCAGACTGGCTGGTCAGCTGCCTCAGCAAAGTCACTTAGACTTAAGGCAG - UNI16357 - - UNI30172 - - UNI331

86 - GTAATAATCTTCAGTAGCCAAGATGTCTTCAGCACCTGATCCTCCAACAGTTAAAAAAGAACCATTAAAAGAGAAAAACTTTGAAAACCCAGGCC

TCCGAGGGGCGCACACAACCACCTTATTTCGAGCTGTGAATCCCGAGCTCTTCATTAAACCC - UNI19751 - - UNI33186 - AACAAACCTGT

GATGGCTTTTGGATTGGTAACCCTTTCACTTTGTGTGGCTTACATTGGTTATCTGCATGCAACTCAAGAGAACAGAAAGGACCTCTATGAAGCCATTGAC

AGTGAAGGGCATCGGTACATGAGGAGAAAAACATCTAAGTGGGACTAACTGCTGCTTCCTTCAGGTGGAGTGTTATTATAGGCTCCGACACCTTTGAAAG

AAAGACTGTTAGTGCACAGAATTGTTTCTTGTTCCATAATATGTTAACAAGGGAGAATATAAAATTGAAAGCAGTCCACTGTGGTGAGTTTAGTCTCATT

ACAGCTGAAGGCATTAAATTCTGTATAATAAAAGTACCCAGTACTCTTCCATTTGCATGGAGTTTCTAACGTTTTAGAGTGGATTGTGCCTTTGCAGCAA

TGCTTTACTGTTTAGGAGAGAAGACAACCCCTTCAGTTACTAAAATCATAATTAAATGAAAGAATAAAACAAA
Translation
 - UNI30172 -  - UNI16357 - - UNI30172 - - UNI33186 - MSSAPDPPTVKKEPLKEKNFENPGLRGAHTTTLFRAVNPELFIKP 

- UNI19751 - - UNI33186 - NKPVMAFGLVTLSLCVAYIGYLHATQENRKDLYEAIDSEGHRYMRRKTSKWD
Transcript ENSMUST00000108134
Sequence
GCAGCGGGCGTTCGCACGGGACGCCGGAAGTCTCTGAGCCTGGCGGCGTCCGAGCTGAAGCTTCCCCGGCTTCCCAATTGCCCAAGGTCAGGCTCCGCCA

GCCCTCGAAGGGGAGGGTTGTGGTTTGCAGAAGATGCTAGG - UNI16357 - - UNI30172 - - UNI33186 - GTAATAATCTTCAGTAGCC

AAGATGTCTTCAGCACCTGATCCTCCAACAGTTAAAAAAGAACCATTAAAAGAGAAAAACTTTGAAAACCCAGGCCTCCGAGGGGCGCACACAACCACCT

TATTTCGAGCTGTGAATCCCGAGCTCTTCATTAAACCC - UNI19751 - - UNI33186 - AACAAACCTGTGATGGCTTTTGGATTGGTAACCCT

TTCACTTTGTGTGGCTTACATTGGTTATCTGCATGCAACTCAAGAGAACAGAAAGGACCTCTATGAAGCCATTGACAGTGAAGGGCATCGGTACATGAGG

AGAAAAACATCTAAGTGGGACTAACTGCTGCTTCCTTCAGGTGGAGTGTTATTATAGGCTCCGACACCTTTGAAAGAAAGACTGTTAGTGCACAGAATTG

TTTCTTGTTCCATAATATGTTAACAAGGGAGAATATAAAATTGAAAGCAGTCCACTGTGGTGAGTTTAGTCTCATTACAGCTGAAGGCATTAAATTCTGT

ATAATAAAAGTACCCAGTACTCTTCCATTTGCATGGAGTTTCTAACGTTTTAGAGTGGATTGTGCCTTTGCAGCAATGCTTTACTGTTTAGGAGAGAAGA

CAACCCCTTCAGTTACTAAAATCATAATTAAATGAAAGAATAAAACAAA
Translation
 - UNI16357 - - UNI30172 - - UNI33186 - MSSAPDPPTVKKEPLKEKNFENPGLRGAHTTTLFRAVNPELFIKP - UNI19751 - -

 UNI33186 - NKPVMAFGLVTLSLCVAYIGYLHATQENRKDLYEAIDSEGHRYMRRKTSKWD
Transcript ENSMUST00000029972
Sequence
GCCCCGGCGGGAACGCGCACTGGTTGGGCGCGCACCGGGCGAACCGGAAGGAAAGTCCAGCAGCGGGCGTTCGCACGGGACGCCGGAAGTCTCTGAGCCT

GGCGGCGTCCGAGCTGAAGCTTCCCCGGCTTCCCAATTGCCCAAG - UNI16357 - - UNI30172 - - UNI33186 - GTAATAATCTTCAGT

AGCCAAGATGTCTTCAGCACCTGATCCTCCAACAGTTAAAAAAGAACCATTAAAAGAGAAAAACTTTGAAAACCCAGGCCTCCGAGGGGCGCACACAACC

ACCTTATTTCGAGCTGTGAATCCCGAGCTCTTCATTAAACCC - UNI19751 - - UNI33186 - AACAAACCTGTGATGGCTTTTGGATTGGTAA

CCCTTTCACTTTGTGTGGCTTACATTGGTTATCTGCATGCAACTCAAGAGAACAGAAAGGACCTCTATGAAGCCATTGACAGTGAAGGGCATCGGTACAT

GAGGAGAAAAACATCTAAGTGGGACTAACTGCTGCTTCCTTCAGGTGGAGTGTTATTATAGGCTCCGACACCTTTGAAAGAAAGACTGTTAGTGCACAGA

ATTGTTTCTTGTTCCATAATATGTTAACAAGGGAGAATATAAAATTGAAAGCAGTCCACTGTGGTGAGTTTAGTCTCATTACAGCTGAAGGCATTAAATT

CTGTATAATAAAAGTACCCAGTACTCTTCCATTTGCATGGAGTTTCTAACGTTTTAGAGTGGATTGTGCCTTTGCAGCAATGCTTTACTGTTTAGGAGAG

AAGACAACCCCTTCAGTTACTAAAATCATAATTAAATGAAAGAATAAAACAAA
Translation
 - UNI16357 - - UNI30172 - - UNI33186 - MSSAPDPPTVKKEPLKEKNFENPGLRGAHTTTLFRAVNPELFIKP - UNI19751 - -

 UNI33186 - NKPVMAFGLVTLSLCVAYIGYLHATQENRKDLYEAIDSEGHRYMRRKTSKWD
Transcript ENSMUST00000108133
Sequence
AAGTCTCTGAGCCTGGCGGCGTCCGAGCTGAAGCTTCCCCGGCTTCCCAATTGCCCAAGGTCAGGCTCCGCCAGCCCTCGAAGGGGAGGGTTGTGGTTTG

CAGAAGATGCTAGG - UNI30172 - AGTTAACCAGCTTATCCAGAGAGGCTTCTGGCTAATTCACCAGACAAAGGAGCAGCAGCAGTAAATCCTTTC

ACTTCATCCCCTGCTGTTTTATGATGAGGTGCTAAATAGCTTCTGGCCTCTGAGGAACTCAGACTGGCTGGTCAGCTGCCTCAGCAAAGTCACTTAGACT

TAAGGCAG - UNI16357 - - UNI30172 - - UNI33186 - GTAATAATCTTCAGTAGCCAAGATGTCTTCAGCACCTGATCCTCCAACAGTT

AAAAAAGAACCATTAAAAGAGAAAAACTTTGAAAACCCAGGCCTCCGAGGGGCGCACACAACCACCTTATTTCGAGCTGTGAATCCCGAGCTCTTCATTA

AACCC - UNI19751 - - UNI33186 - AACAAACCTGTGATGGCTTTTGGATTGGTAACCCTTTCACTTTGTGTGGCTTACATTGGTTATCTGCA

TGCAACTCAAGAGAACAGAAAGGACCTCTATGAAGCCATTGACAGTGAAGGGCATCGGTACATGAGGAGAAAAACATCTAAGTGGGACTAACTGCTGCTT

CCTTCAGGTGGAGTGTTATTATAGGCTCCGACACCTTTGAAAGAAAGACTGTTAGTGCACAGAATTGTTTCTTGTTCCATAATATGTTAACAAGGGAGAA

TATAAAATTGAAAGCAGTCCACTGTGGTGAGTTTAGTCTCATTACAGCTGAAGGCATTAAATTCTGTATAATAAAAGTACCCAGTACTCTTCCATTTGCA

TGGAGTTTCTAACGTTTTAGAGTGGATTGTGCCTTTGCAGCAATGCTTTACTGTTTAGGAGAGAAGACAACCCCTTCAGTTACTAAAATCATAATTAAAT

GAAAGAAT
Translation
 - UNI30172 -  - UNI16357 - - UNI30172 - - UNI33186 - MSSAPDPPTVKKEPLKEKNFENPGLRGAHTTTLFRAVNPELFIKP 

- UNI19751 - - UNI33186 - NKPVMAFGLVTLSLCVAYIGYLHATQENRKDLYEAIDSEGHRYMRRKTSKWD

For any suggestions or comments, please send an email to unitrap@crg.es