Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028382 (Rod1)
Chromosomal location
Chr 4: 59487938 - 59562168 (-)
Description
ROD1 regulator of differentiation 1 (S. pombe) Gene [Source:MGI (curated);Acc:Rod1-001]
RefSeq_dna
NM_144904 NM_178164 
RefSeq_peptide
NP_659153.1 NP_835458.1 
UniGene
Mm.389581 Mm.475882 
MGI
MGI:1923334 
Uniprot/SWISSPROT
Q8BHD7 
Uniprot/SPTREMBL
A2ANH1 A2ANH2 Q8C5Q1 A2ANH0 
Human Ortholog
ENSG00000119314 (ROD1)
Omim not available
UniTrap UNI36337
Vector Insertion
Chr 4: 59559020 - 59562147
Public Clones IST14437H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29837
Vector Insertion
Chr 4: 59537726 - 59559055
Public Clones (sanger) E051H08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9113
Vector Insertion
Chr 4: 59507483 - 59514241
Public Clones XK552 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18457
Vector Insertion
Chr 4: 59495510 - 59498210
Public Clones not available
Private Clones OST423054 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107530
Sequence
ATGATATGGAAATTAATAATTTTAAAAAATTTGACCAGTATAG - UNI29837 - TTTTAGAA CGGGGATCTGATGAGCTTCTGTCTTCTGGTGTCA

TTAACGGACCTTCTACCATGAACAGCTCGACTTCTGCAGGTGTGTATG CTAATGGGAATGACAACAAGAAATTTAAAGGAGATAGACCTCCCTGTTCGC

CTTCCCGTGTTCTCCATCTTCGAAAAATTCCATGTGATGTCACCGAAGCAGAGGTCATATCATTAGGTCTACCATTTGGCAAAGTAACTAATCTTTTGAT

GTTGAAAGGAAAAAGCCAG GCCTTTTTAGAAATGGCTTCTGAAGAAGCTGCTGTTACTATGATAAATTATTACACTCCTGTTACTCCTCATCTTCGAAG

TCAGCCTGTTTATATCCAGTATTCCAATCACCGAGAACTTAAGACTGACAATCTGCCTAATCAGGCT AGAGCCCAAGCTGCACTGCAGGCTGTCAGTGC

AGTCCAGTCAGGAAACTTGTCCCTTCCTGGAGCTACTGCAAATGAAGGCACATTGCTACCTGGGCAGAGCCCT
Translation
MIWKLIILKNLTSIV - UNI29837 - VLE RGSDELLSSGVINGPSTMNSSTSAGVYA ANGNDNKKFKGDRPPCSPSRVLHLRKIPCDVTEAEVIS

LGLPFG  
Transcript ENSMUST00000102883
Sequence
CTCTGACCGGCCGGAGCTGCGGAGCGGCTCCGCTCGCTGGTTTCCCGGAGCCGCCGCCCGCTTTCTCCGCCCGCGGTGAGCCCGTCAATCCCCGCACAAC

GCGCTCCTCCATCTGGGCCATGGATGG - UNI29837 - - UNI36337 - TGTTGTTACAGATCTTATAGCAGTCGGTTTAAAG - UNI29837 

- - UNI36337 - CGGGGATCTGATGAGCTTCTGTCTTCTGGTGTCATTAACGGACCTTCTACCATGAACAGCTCGACTTCTGCAG CTAATGGGAAT

GACAACAAGAAATTTAAAGGAGATAGACCTCCCTGTTCGCCTTCCCGTGTTCTCCATCTTCGAAAAATTCCATGTGATGTCACCGAAGCAGAGGTCATAT

CATTAGGTCTACCATTTGGCAAAGTAACTAATCTTTTGATGTTGAAAGGAAAAAGCCAG GCCTTTTTAGAAATGGCTTCTGAAGAAGCTGCTGTTACTA

TGATAAATTATTACACTCCTGTTACTCCTCATCTTCGAAGTCAGCCTGTTTATATCCAGTATTCCAATCACCGAGAACTTAAGACTGACAATCTGCCTAA

TCAGGCT AGAGCCCAAGCTGCACTGCAGGCTGTCAGTGCAGTCCAGTCAGGAAACTTGTCCCTTCCTGGAGCTACTGCAAATGAAGGCACATTGCTACC

TGGGCAGAGCCCTGTGCTCCGGATAATTATTGAAAACCTATTTTACCCTGTCACTCTGGAAGTTCTCCATCAG - UNI9113 - ATATTTTCTAAATT

TGGCACGGTGTTGAAGATTATCACCTTTACAAAGAATAATCAGTTTCAAGCCTTGCTTCAGTATGCCGACCCAGTGAATGCGCAGTATGCCAAAATG GC

TCTGGATGGCCAGAATATCTACAATGCGTGCTGCACTCTCCGTATTGACTTCTCCAAGCTCACCAGCCTTAATGTGAAATACAATAATGACAAAAGCAGA

GACTTCACTCGCTTAGACCTTCCTACTGGTGACGGCCAGCCATCTCTTGAACCTCCTATGGCTGCTGCTTTTG GTGCACCGGGTATAATGTCCTCTCCA

TATGCAGGGGCTGCTGGCTTTGCCCCAGCCATCGCATTTCCTCAAGCAGCAG GTCTGTCTGTCCCAGCTGTTCCCGGAGCCCTTGGTCCTCTCACACTT

ACCTCCTCTGCTGTCAGTGGAAGGATGGCCATTCCTGGGGCAAGTGGTATGCCTGGGAATTCTGTTCTGCTGGTCACCAACCTCAATCCTGAC TTTATC

ACACCACATGGGCTTTTTATCCTATTTG - UNI18457 - GAGTGTATGGTGATGTACATCGAGTGAAGATTATGTTTAACAAGAAAGAAAACGCCTT

GGTGCAGATGGCGGATGCGAGTCAAGCCCAGCTAG CAATGAACCACCTAAGTGGTCAGAGGCTCTATGGAAAAGTACTTCGGGCTACACTGTCCAAACA

TCAAGCCGTCCAGCTCCCTAGAGAGGGACAGGAAGACCAAGGTCTGACCAAGGACTTCAGCAATAGTCCCCTGCATCGCTTTAAAAAGCCCGGCTCAAAG

AATTTCCAAAATATCTTCCCTCCATCAGCCACACTTCATCTTTCCAACATTCC TCCTTCTGTCACAATGGATGACCTGAAGAACCTGTTCACAGAAGCT

GGATGCTCAGTGAAGGCTTTTAAGTTCTTCCA GAAAGACCGTAAGATGGCTCTCATTCAGTTGGGATCTGTGGAAGAAGCAATCCAGGCTCTTATTGAG

CTTCACAATCATGACCTTGGAGAGAATCACCACCTCAGAGTTTCCTTCTCAAAATCCACCATCTGACCTTCCCGTGAAATTGTCTCCTTATACTGGACCA

CAGTTTCTGTAAGATCTTCAGGCACAGACTGAAGCAGCTCAAGACCATTTCTGCCTCTTCACAAAATAACTCTTCGGGAATTTGATATTCGAGAACAGTC

AAAACAAGAGAGAGTCCTTTTCTTCCTCTCGTTTTCCCCAACAGTGTATGATCAAAAGTTTGCTTTGCCTTTGTATTGTGGTTTCTATGAAAATAACTTT

CGGGGGGAAAAAATCAGGAAAATCTTTTTAAAATAATTTAATTCCCTGAATGAGATTTAAAAAGGACAGAGTTTCTTTCTGTTTGGGTCCAGAGCAGCCT

TACATGACATTTCTAAACTCCTTTGTACTTTGAGAAATTTAAACATACAGACTTTTACAATTTCTTGATGTAATTTAAATCACCTACAACCAAGTTTTTT

TAACTTTATGATTCAGAAGTTTCCCTGTAGAAAATGACATTCATTCACTTATAAAAATTATACCAGATATTTGCATCTATTGATAGTTATTATACATAAC

TACATGGAGATATATTGGAAACAGGTTTATAAACGTGCATGCTTTCTTTCAGATTTCTTTTTTCCCCCCACTGTAGCACACTCCTTTAAATAATGTCCAT

CTTCTCTTTTTAAGACCATTTGGAAAAGCAAAGTGTTGCAGTTGTCCCCAGGGAAACAGAAGTGAAATTCAGCCTGGATCTTTTACAATATCAGCATAAT

TAGTCATTTTAGGAAAAAAAATCATGTTTTAAATTTCAAAATGACACTGTCTAGTAATGTAATGTGATCTTGGAAAATTTTAAAAGAAAAATAATCCTAC

TTTTTTATAATTGTTTTCAGAAAAAAAGTTTACAGTCTTAAGGAAAAATATTCAGGTCTATCATATGGTTTGACAGATTTTTTAAAAGTTATTTTTGGTA

AGGTCTTCTTTTAGAAAAAAAAATCTCAAGGGTTTTTTGTACCACTATAATCTCTAATACTCAGAATTACTGTGTATTTACTTAATTTCTTATTATGTGC

CTTATTATGTGCTTAAGATACAATAGATTAGAATTTTATCTAAATATCTAGAAAGATAAATTGTGGGCTTGGTGAGCATTCTGTTATTTTTTCCTGTCTT

GGATTTTAAGGGTTTTGGTTGTTTTTGTTTTGTTTTTTTCTTTTTTTCTCGTTGCAATTTTAAGTGGTTTTCAATAAGTAATAGTTTCTACTCAGATTTT

TGGTGCTTTGGGATAGTGGTGGGATAGAGAAGGGTGAGTGGATTGGGAATAAATAACTCAGTGTGCACCTGTAGGCCTCTCTAGGTTGGCTGCCGCCAGC

CGTCAGGGAAGTCTGAGCTGTAGACCTGCAGACTCGGATCTCTGTCTGTCTGCCTTCACTGCCCGTTAGATTTTGTCTCAGGATTACTTGATTCCTTCTC

AGCACTCAAGTGAGAACCTGATTTTCTCTGTTAATGCGACTTCATTACAGATAGCCCACATATTTGGAGTATGAGAAAGTGGGTTATTTTTTTATATTCT

GACCCTCTTACTTTTTTGGTTGAATGTAAAAAGTACATATTAATGTTGCTTCAATGATTGTGTCATGTAAAATTACTTTTTAATATG
Translation
 - UNI29837 - - UNI36337 -  - UNI29837 - - UNI36337 - MNSSTSAA ANGNDNKKFKGDRPPCSPSRVLHLRKIPCDVTEAEVI

SLGLPFGKVTNLLMLKGKSQ AFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQA RAQAALQAVSAVQSGNLSLPGATANEGTL

LPGQSPVLRIIIENLFYPVTLEVLHQ - UNI9113 - IFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKM ALDGQNIYNACCTLRIDFSKLTS

LNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAAAFG GAPGIMSSPYAGAAGFAPAIAFPQAAG GLSVPAVPGALGPLTLTSSAVSGRMAIPGASGMPG

NSVLLVTNLNPD FITPHGLFILFG - UNI18457 - GVYGDVHRVKIMFNKKENALVQMADASQAQLA AMNHLSGQRLYGKVLRATLSKHQAVQLP

REGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIP PPSVTMDDLKNLFTEAGCSVKAFKFFQ QKDRKMALIQLGSVEEAIQALIELHN

HDLGENHHLRVSFSKSTI
Transcript ENSMUST00000107535
Sequence
ATGAACAGCTCGACTTCTGCAG CTAATGGGAATGACAACAAGAAATTTAAAGGAGATAGACCTCCCTGTTCGCCTTCCCGTGTTCTCCATCTTCGAAAA

ATTCCATGTGATGTCACCGAAGCAGAGGTCATATCATTAGGTCTACCATTTGGCAAAGTAACTAATCTTTTGATGTTGAAAGGAAAAAGCCAG GCCTTT

TTAGAAATGGCTTCTGAAGAAGCTGCTGTTACTATGATAAATTATTACACTCCTGTTACTCCTCATCTTCGAAGTCAGCCTGTTTATATCCAGTATTCCA

ATCACCGAGAACTTAAGACTGACAATCTGCCTAATCAGGCT AGAGCCCAAGCTGCACTGCAGGCTGTCAGTGCAGTCCAGTCAGGAAACTTGTCCCTTC

CTGGAGCTACTGCAAATGAAGGCACATTGCTACCTGGGCAGAGCCCTGTGCTCCGGATAATTATTGAAAACCTATTTTACCCTGTCACTCTGGAAGTTCT

CCATCAG - UNI9113 - ATATTTTCTAAATTTGGCACGGTGTTGAAGATTATCACCTTTACAAAGAATAATCAGTTTCAAGCCTTGCTTCAGTATGC

CGACCCAGTGAATGCGCAGTATGCCAAAATG GCTCTGGATGGCCAGAATATCTACAATGCGTGCTGCACTCTCCGTATTGACTTCTCCAAGCTCACCAG

CCTTAATGTGAAATACAATAATGACAAAAGCAGAGACTTCACTCGCTTAGACCTTCCTACTGGTGACGGCCAGCCATCTCTTGAACCTCCTATGGCTGCT

GCTTTTG GTGCACCGGGTATAATGTCCTCTCCATATGCAGGGGCTGCTGGCTTTGCCCCAGCCATCGCATTTCCTCAAGCAGCAG GTCTGTCTGTCCC

AGCTGTTCCCGGAGCCCTTGGTCCTCTCACACTTACCTCCTCTGCTGTCAGTGGAAGGATGGCCATTCCTGGGGCAAGTGGTATGCCTGGGAATTCTGTT

CTGCTGGTCACCAACCTCAATCCTGAC TTTATCACACCACATGGGCTTTTTATCCTATTTG - UNI18457 - GAGTGTATGGTGATGTACATCGAG

TGAAGATTATGTTTAACAAGAAAGAAAACGCCTTGGTGCAGATGGCGGATGCGAGTCAAGCCCAGCTAG CAATGAACCACCTAAGTGGTCAGAGGCTCT

ATGGAAAAGTACTTCGGGCTACACTGTCCAAACATCAAGCCGTCCAGCTCCCTAGAGAGGGACAGGAAGACCAAGGTCTGACCAAGGACTTCAGCAATAG

TCCCCTGCATCGCTTTAAAAAGCCCGGCTCAAAGAATTTCCAAAATATCTTCCCTCCATCAGCCACACTTCATCTTTCCAACATTCC TCCTTCTGTCAC

AATGGATGACCTGAAGAACCTGTTCACAGAAGCTGGATGCTCAGTGAAGGCTTTTAAGTTCTTCCA GAAAGACCGTAAGATGGCTCTCATTCAGTTGGG

ATCTGTGGAAGAAGCAATCCAGGCTCTTATTGAGCTTCACAATCATGACCTTGGAGAGAATCACCACCTCAGAGTTTCCTTCTCAAAATCCACCATCTGA

CCTTCCCGTGAAATTGTCTCCTTATACTGGACCACAGTTTCTGTAAGATCTTCAGGCACAGACTGAAGCAGCTCAAGACCATTTCTGCCTCTTCACAAAA

TAACTCTTCGGGAATTTGATATTCGAGAACAGTCAAAACAAGAGAGAGTCCTTTTCTTCCTCTCGTTTTCCCCAACAGTGTATGATCAAAAGTTTGCTTT

GCCTTTGTATTGTGGTTTCTATGAAAATAACTTTCGGGGGGAAAAAATCAGGAAAATCTTTTTAAAATAATTTAATTCCCTGAATGAGATTTAAAAAGGA

CAGAGTTTCTTTCTGTTTGGGTCCAGAGCAGCCTTACATGACATTTCTAAACTCCTTTGTACTTTGAGAAATTTAAACATACAGACTTTTACAATTTCTT

GATGTAATTTAAATCACCTACAACCAAGTTTTTTTAACTTTATGATTCAGAAGTTTCCCTGTAGAAAATGACATTCATTCACTTATAAAAATTATACCAG

ATATTTGCATCTATTGATAGTTATTATACATAACTACATGGAGATATATTGGAAACAGGTTTATAAACGTGCATGCTTTCTTTCAGATTTCTTTTTTCCC

CCCACTGTAGCACACTCCTTTAAATAATGTCCATCTTCTCTTTTTAAGACCATTTGGAAAAGCAAAGTGTTGCAGTTGTCCCCAGGGAAACAGAAGTGAA

ATTCAGCCTGGATCTTTTACAATATCAGCATAATTAGTCATTTTAGGAAAAAAAATCATGTTTTAAATTTCAAAATGACACTGTCTAGTAATGTAATGTG

ATCTTGGAAAATTTTAAAAGAAAAATAATCCTACTTTTTTATAATTGTTTTCAGAAAAAAAGTTTACAGTCTTAAGGAAAAATATTCAGGTCTATCATAT

GGTTTGACAGATTTTTTAAAAGTTATTTTTGGTAAGGTCTTCTTTTAGAAAAAAAAATCTCAAGGGTTTTTTGTACCACTATAATCTCTAATACTCAGAA

TTACTGTGTATTTACTTAATTTCTTATTATGTGCCTTATTATGTGCTTAAGATACAATAGATTAGAATTTTATCTAAATATCTAGAAAGATAAATTGTGG

GCTTGGTGAGCATTCTGTTATTTTTTCCTGTCTTGGATTTTAAGGGTTTTGGTTGTTTTTGTTTTGTTTTTTTCTTTTTTTCTCGTTGCAATTTTAAGTG

GTTTTCAATAAGTAATAGTTTCTACTCAGATTTTTGGTGCTTTGGGATAGTGGTGGGATAGAGAAGGGTGAGTGGATTGGGAATAAATAACTCAGTGTGC

ACCTGTAGGCCTCTCTAGGTTGGCTGCCGCCAGCCGTCAGGGAAGTCTGAGCTGTAGACCTGCAGACTCGGATCTCTGTCTGTCTGCCTTCACTGCCCGT

TAGATTTTGTCTCAGGATTACTTGATTCCTTCTCAGCACTCAAGTGAGAACCTGATTTTCTCTGTTAATGCGACTTCATTACAGATAGCCCACATATTTG

GAGTATGAGAAAGTGGGTTATTTTTTTATATTCTGACCCTCTTACTTTTTTGGTTGAATGTAAAAAGTACATATTAATGTTGCTTCAATGATTGTGTCAT

GTAAAATTACTTTTTAATATGAAACTGCTTTTGTTAATTATTTCTTCAATGCGTGATTGGCTTTTAAAATACAGAATTTGTCAGAGGAATCAATTTTGTC

CACCCCTTCTCACTTTTAATAATCTCAGAGTGGATCATCTCATCTTTTTAAAATATCTCAGTCTTTACTTTCAGCCATTAATTTGAACATTCTTTTAAAA

AAAAAAAAGAATGAAGG
Translation
MNSSTSAA ANGNDNKKFKGDRPPCSPSRVLHLRKIPCDVTEAEVISLGLPFGKVTNLLMLKGKSQ AFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQ

YSNHRELKTDNLPNQA RAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSPVLRIIIENLFYPVTLEVLHQ - UNI9113 - IFSKFGTVLKIITFT

KNNQFQALLQYADPVNAQYAKM ALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAAAFG GAPGIMSSPYAGAAGFA

PAIAFPQAAG GLSVPAVPGALGPLTLTSSAVSGRMAIPGASGMPGNSVLLVTNLNPD FITPHGLFILFG - UNI18457 - GVYGDVHRVKIMFNK

KENALVQMADASQAQLA AMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIP PPSVTMDD

LKNLFTEAGCSVKAFKFFQ QKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI
Transcript ENSMUST00000030076
Sequence
TGTTTCCCACTCTTCCTTCCACCTCTGACCGGCCGGAGCTGCGGAGCGGCTCCGCTCGCTGGTTTCCCGGAGCCGCCGCCCGCTTTCTCCGCCCGCGGTG

AGCCCGTCAATCCCCGCACAACGCGCTCCTCCATCTGGGCCATGGATGG - UNI29837 - - UNI36337 - CGGGGATCTGATGAGCTTCTGTCT

TCTGGTGTCATTAACGGACCTTCTACCATGAACAGCTCGACTTCTGCAGGTGTGTATG CTAATGGGAATGACAACAAGAAATTTAAAGGAGATAGACCT

CCCTGTTCGCCTTCCCGTGTTCTCCATCTTCGAAAAATTCCATGTGATGTCACCGAAGCAGAGGTCATATCATTAGGTCTACCATTTGGCAAAGTAACTA

ATCTTTTGATGTTGAAAGGAAAAAGCCAG GCCTTTTTAGAAATGGCTTCTGAAGAAGCTGCTGTTACTATGATAAATTATTACACTCCTGTTACTCCTC

ATCTTCGAAGTCAGCCTGTTTATATCCAGTATTCCAATCACCGAGAACTTAAGACTGACAATCTGCCTAATCAGGCT AGAGCCCAAGCTGCACTGCAGG

CTGTCAGTGCAGTCCAGTCAGGAAACTTGTCCCTTCCTGGAGCTACTGCAAATGAAGGCACATTGCTACCTGGGCAGAGCCCTGTGCTCCGGATAATTAT

TGAAAACCTATTTTACCCTGTCACTCTGGAAGTTCTCCATCAG - UNI9113 - ATATTTTCTAAATTTGGCACGGTGTTGAAGATTATCACCTTTAC

AAAGAATAATCAGTTTCAAGCCTTGCTTCAGTATGCCGACCCAGTGAATGCGCAGTATGCCAAAATG GCTCTGGATGGCCAGAATATCTACAATGCGTG

CTGCACTCTCCGTATTGACTTCTCCAAGCTCACCAGCCTTAATGTGAAATACAATAATGACAAAAGCAGAGACTTCACTCGCTTAGACCTTCCTACTGGT

GACGGCCAGCCATCTCTTGAACCTCCTATGGCTGCTGCTTTTG GTGCACCGGGTATAATGTCCTCTCCATATGCAGGGGCTGCTGGCTTTGCCCCAGCC

ATCGCATTTCCTCAAGCAGCAG GTCTGTCTGTCCCAGCTGTTCCCGGAGCCCTTGGTCCTCTCACACTTACCTCCTCTGCTGTCAGTGGAAGGATGGCC

ATTCCTGGGGCAAGTGGTATGCCTGGGAATTCTGTTCTGCTGGTCACCAACCTCAATCCTGAC TTTATCACACCACATGGGCTTTTTATCCTATTTG -

 UNI18457 - GAGTGTATGGTGATGTACATCGAGTGAAGATTATGTTTAACAAGAAAGAAAACGCCTTGGTGCAGATGGCGGATGCGAGTCAAGCCCA

GCTAG CAATGAACCACCTAAGTGGTCAGAGGCTCTATGGAAAAGTACTTCGGGCTACACTGTCCAAACATCAAGCCGTCCAGCTCCCTAGAGAGGGACA

GGAAGACCAAGGTCTGACCAAGGACTTCAGCAATAGTCCCCTGCATCGCTTTAAAAAGCCCGGCTCAAAGAATTTCCAAAATATCTTCCCTCCATCAGCC

ACACTTCATCTTTCCAACATTCC TCCTTCTGTCACAATGGATGACCTGAAGAACCTGTTCACAGAAGCTGGATGCTCAGTGAAGGCTTTTAAGTTCTTC

CA GAAAGACCGTAAGATGGCTCTCATTCAGTTGGGATCTGTGGAAGAAGCAATCCAGGCTCTTATTGAGCTTCACAATCATGACCTTGGAGAGAATCAC

CACCTCAGAGTTTCCTTCTCAAAATCCACCATCTGACCTTCCCGTGAAATTGTCTCCTTATACTGGACCACAGTTTCTGTAAGATCTTCAGGCACAGACT

GAAGCAGCTCAAGACCATTTCTGCCTCTTCACAAAATAACTCTTCGGGAATTTGATATTCGAGAACAGTCAAAACAAGAGAGAGTCCTTTTCTTCCTCTC

GTTTTCCCCAACAGTGTATGATCAAAAGTTTGCTTTGCCTTTGTATTGTGGTTTCTATGAAAATAACTTTCGGGGGGAAAAAATCAGGAAAATCTTTTTA

AAATAATTTAATTCCCTGAATGAGATTTAAAAAGGACAGAGTTTCTTTCTGTTTGGGTCCAGAGCAGCCTTACATGACATTTCTAAACTCCTTTGTACTT

TGAGAAATTTAAACATACAGACTTTTACAATTTCTTGATGTAATTTAAATCACCTACAACCAAGTTTTTTTAACTTTATGATTCAGAAGTTTCCCTGTAG

AAAATGACATTCATTCACTTATAAAAATTATACCAGATATTTGCATCTATTGATAGTTATTATACATAACTACATGGAGATATATTGGAAACAGGTTTAT

AAACGTGCATGCTTTCTTTCAGATTTCTTTTTTCCCCCCACTGTAGCACACTCCTTTAAATAATGTCCATCTTCTCTTTTTAAGACCATTTGGAAAAGCA

AAGTGTTGCAGTTGTCCCCAGGGAAACAGAAGTGAAATTCAGCCTGGATCTTTTACAATATCAGCATAATTAGTCATTTTAGGAAAAAAAATCATGTTTT

AAATTTCAAAATGACACTGTCTAGTAATGTAATGTGATCTTGGAAAATTTTAAAAGAAAAATAATCCTACTTTTTTATAATTGTTTTCAGAAAAAAAGTT

TACAGTCTTAAGGAAAAATATTCAGGTCTATCATATGGTTTGACAGATTTTTTAAAAGTTATTTTTGGTAAGGTCTTCTTTTAGAAAAAAAAATCTCAAG

GGTTTTTTGTACCACTATAATCTCTAATACTCAGAATTACTGTGTATTTACTTAATTTCTTATTATGTGCCTTATTATGTGCTTAAGATACAATAGATTA

GAATTTTATCTAAATATCTAGAAAGATAAATTGTGGGCTTGGTGAGCATTCTGTTATTTTTTCCTGTCTTGGATTTTAAGGGTTTTGGTTGTTTTTGTTT

TGTTTTTTTCTTTTTTTCTCGTTGCAATTTTAAGTGGTTTTCAATAAGTAATAGTTTCTACTCAGATTTTTGGTGCTTTGGGATAGTGGTGGGATAGAGA

AGGGTGAGTGGATTGGGAATAAATAACTCAGTGTGCACCTGTAGGCCTCTCTAGGTTGGCTGCCGCCAGCCGTCAGGGAAGTCTGAGCTGTAGACCTGCA

GACTCGGATCTCTGTCTGTCTGCCTTCACTGCCCGTTAGATTTTGTCTCAGGATTACTTGATTCCTTCTCAGCACTCAAGTGAGAACCTGATTTTCTCTG

TTAATGCGACTTCATTACAGATAGCCCACATATTTGGAGTATGAGAAAGTGGGTTATTTTTTTATATTCTGACCCTCTTACTTTTTTGGTTGAATGTAAA

AAGTACATATTAATGTTGCTTCAATGATTGTGTCATGTAAAATTACTTTTTAATATGAAACTGCTTTTGTTAATTATTTCTTCAATGCGTGATTGGCTTT

TAAAATACAGAATTTGTCAGAGGAATCAATTTTGTCCACCCCTTCTCACTTTTAATAATCTCAGAGTGGATCATCTCATCTTTTTAAAATATCTCAGTCT

TTACTTTCAGCCATTAATTTGAACATTCTTTTAAAAAAAAAAAAGAATGAAGG
Translation
 - UNI29837 - - UNI36337 - MNSSTSAGVYA ANGNDNKKFKGDRPPCSPSRVLHLRKIPCDVTEAEVISLGLPFGKVTNLLMLKGKSQ AFL

EMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQA RAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSPVLRIIIENLFYPVTLEVL

HQ - UNI9113 - IFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKM ALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPTGDGQ

PSLEPPMAAAFG GAPGIMSSPYAGAAGFAPAIAFPQAAG GLSVPAVPGALGPLTLTSSAVSGRMAIPGASGMPGNSVLLVTNLNPD FITPHGLFILF

G - UNI18457 - GVYGDVHRVKIMFNKKENALVQMADASQAQLA AMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKP

GSKNFQNIFPPSATLHLSNIP PPSVTMDDLKNLFTEAGCSVKAFKFFQ QKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI

For any suggestions or comments, please send an email to unitrap@crg.es