Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028397 (Jmjd2c)
Chromosomal location
Chr 4: 73888401 - 74051765 (+)
Description
jumonji domain containing 2C Gene [Source:MGI (curated);Acc:Jmjd2c-006]
RefSeq_dna
NM_144787 
RefSeq_peptide
NP_659036.1 
UniGene
Mm.405821 
MGI
MGI:1924054 
Uniprot/SWISSPROT
Q8VCD7 
Uniprot/SPTREMBL
Q3UMI0 Q8BXY9 
Human Ortholog
ENSG00000107077 (JMJD2C)
Omim not available
UniTrap UNI36038
Vector Insertion
Chr 4: 73888545 - 73897782
Public Clones IST14277F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8501
Vector Insertion
Chr 4: 73897991 - 73908712
Public Clones (sanger) RRK464 (baygenomics) P093E10 (ggtc) P098C09 (ggtc) P107B02 (ggtc)
E044C06 (ggtc) D144E08 (ggtc) 3SE314B05 (ggtc) W177D08 (ggtc) P142A07 (ggtc)
H008B09 (ggtc) D172C05 (ggtc) D048C05 (ggtc) P120E09 (ggtc) E080G04 (ggtc)
D153G06 (ggtc) 5SE285C01 (ggtc) P013D11 (ggtc) P143F01 (ggtc) E038D11 (ggtc)
D116A03 (ggtc) P126G07 (ggtc) E091B10 (ggtc) D158B02 (ggtc) D045A08 (ggtc)
P111F05 (ggtc) P118B04 (ggtc) E069G12 (ggtc) 5SP146B01 (ggtc) W223A04 (ggtc)
D173B06 (ggtc) D101A06 (ggtc) E091B09 (ggtc) D028C01 (ggtc) FHCRC-GT-S3-2A1 (fhcrc)
FHCRC-GT-S18-5A1 (fhcrc) FHCRC-GT-S1-7B1 (fhcrc) FHCRC-GT-S18-12E1 (fhcrc)
PST23723-NR (escells) IST12272E7 (tigm) IST14446D2 (tigm) IST12353G4 (tigm)
IST14251F4 (tigm) IST12002E11 (tigm) IST14629G1 (tigm) IST14936G1 (tigm)
IST14189B6 (tigm) IST14971E1 (tigm) IST14453E9 (tigm) IST15066E11 (tigm)
IST10104A2 (tigm) IST12104C6 (tigm) IST13339B1 (tigm) IST10040F7 (tigm)
IST14488A5 (tigm) IST10440E12 (tigm) IST14187A3 (tigm) IST12236H2 (tigm)
IST12486E11 (tigm) IST12393E2 (tigm) IST11329A8 (tigm) IST14586G2 (tigm)
IST14293B2 (tigm) IST14138F11 (tigm) IST14385D9 (tigm) IST14473H3 (tigm)
IST15039D11 (tigm) IST14375A12 (tigm) IST14614A2 (tigm) IST14153A3 (tigm)
IST13201H1 (tigm) IST14868G11 (tigm) IST10854H9 (tigm) IST11627E1 (tigm)
IST14491D4 (tigm) IST10710B3 (tigm) IST13600G12 (tigm) IST10126E7 (tigm)
IST10546G5 (tigm) IST13119B5 (tigm) IST14157A1 (tigm) IST14453C3 (tigm)
IST13124D1 (tigm) IST11727B10 (tigm) IST14541G3 (tigm) IST13220E1 (tigm)
IST11406A4 (tigm) IST11091D9 (tigm) IST12378E8 (tigm) IST14270H3 (tigm)
IST13201G2 (tigm) IST11615E5 (tigm) IST12937B2 (tigm) IST14501H5 (tigm)
IST11261B11 (tigm) IST10104B4 (tigm) IST10111A5 (tigm) IST14182B8 (tigm)
IST12937B3 (tigm) IST13545D8 (tigm) IST14251E6 (tigm) IST14136B9 (tigm)
IST14426E10 (tigm) IST14623H2 (tigm) IST12835H12 (tigm) IST14904G2 (tigm)
IST11201A3 (tigm) IST14918E12 (tigm) IST14239H9 (tigm) IST14547E10 (tigm)
IST14300A9 (tigm)
Private Clones OST455621 (lexicon) OST452619 (lexicon) OST451832 (lexicon) OST450925 (lexicon)
OST450747 (lexicon) OST438021 (lexicon) OST434720 (lexicon) OST431963 (lexicon)
OST428492 (lexicon) OST427033 (lexicon) OST424218 (lexicon) OST412659 (lexicon)
OST390024 (lexicon) OST389639 (lexicon) OST319626 (lexicon) OST314376 (lexicon)
OST302688 (lexicon) OST290172 (lexicon) OST285439 (lexicon) OST284077 (lexicon)
OST266543 (lexicon) OST263012 (lexicon) OST262209 (lexicon) OST261650 (lexicon)
OST260972 (lexicon) OST260603 (lexicon) OST260191 (lexicon) OST251656 (lexicon)
OST248987 (lexicon) OST243067 (lexicon) OST233308 (lexicon) OST231792 (lexicon)
OST231071 (lexicon) OST227215 (lexicon) OST226093 (lexicon) OST223339 (lexicon)
OST220839 (lexicon) OST218780 (lexicon) OST218135 (lexicon) OST217101 (lexicon)
OST214415 (lexicon) OST213522 (lexicon) OST213331 (lexicon) OST209098 (lexicon)
OST209036 (lexicon) OST208649 (lexicon) OST207500 (lexicon) OST202339 (lexicon)
OST195549 (lexicon) OST192761 (lexicon) OST192577 (lexicon) OST192557 (lexicon)
OST189310 (lexicon) OST187086 (lexicon) OST181977 (lexicon) OST167140 (lexicon)
OST163874 (lexicon) OST155121 (lexicon) OST151146 (lexicon) OST147660 (lexicon)
OST144852 (lexicon) OST135090 (lexicon) OST126914 (lexicon) OST123495 (lexicon)
OST112798 (lexicon) OST108732 (lexicon) OST104934 (lexicon) OST100768 (lexicon)
OST100731 (lexicon) OST77031 (lexicon) OST65948 (lexicon) OST56235 (lexicon)
OST53684 (lexicon) OST43145 (lexicon) OST35185 (lexicon) OST31087 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16955
Vector Insertion
Chr 4: 73908712 - 73908874
Public Clones not available
Private Clones OST451880 (lexicon) OST438872 (lexicon) OST419720 (lexicon) OST418506 (lexicon)
OST412688 (lexicon) OST405541 (lexicon) OST377035 (lexicon) OST371350 (lexicon)
OST366717 (lexicon) OST365285 (lexicon) OST345307 (lexicon) OST319382 (lexicon)
OST302153 (lexicon) OST291380 (lexicon) OST283430 (lexicon) OST270929 (lexicon)
OST266450 (lexicon) OST260384 (lexicon) OST251052 (lexicon) OST243036 (lexicon)
OST239194 (lexicon) OST238449 (lexicon) OST227078 (lexicon) OST224249 (lexicon)
OST224189 (lexicon) OST221737 (lexicon) OST219939 (lexicon) OST215906 (lexicon)
OST208440 (lexicon) OST206389 (lexicon) OST204723 (lexicon) OST200015 (lexicon)
OST194953 (lexicon) OST193175 (lexicon) OST192301 (lexicon) OST182386 (lexicon)
OST173086 (lexicon) OST169837 (lexicon) OST169819 (lexicon) OST157124 (lexicon)
OST147023 (lexicon) OST138347 (lexicon) OST133803 (lexicon) OST131500 (lexicon)
OST128840 (lexicon) OST123689 (lexicon) OST81658 (lexicon) OST65198 (lexicon)
OST52607 (lexicon) OST45221 (lexicon) OST42135 (lexicon) OST38322 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1552
Vector Insertion
Chr 4: 73908874 - 73917097
Public Clones CC0227 (sanger) D081D11 (ggtc) D160B06 (ggtc) IST15058B9 (tigm) IST12778B4 (tigm)
IST11668A9 (tigm) IST10750D5 (tigm)
Private Clones OST407373 (lexicon) OST391326 (lexicon) OST374307 (lexicon) OST364559 (lexicon)
OST345504 (lexicon) OST329027 (lexicon) OST237009 (lexicon) OST220114 (lexicon)
OST219453 (lexicon) OST209432 (lexicon) OST195045 (lexicon) OST147502 (lexicon)
OST125701 (lexicon) OST103169 (lexicon) OST51655 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20034
Vector Insertion
Chr 4: 73917274 - 73926800
Public Clones not available
Private Clones OST374616 (lexicon) OST346156 (lexicon) OST244722 (lexicon) OST244560 (lexicon)
OST234120 (lexicon) OST224850 (lexicon) OST212523 (lexicon) OST197731 (lexicon)
OST105705 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21625
Vector Insertion
Chr 4: 73926916 - 73944344
Public Clones not available
Private Clones OST323584 (lexicon) OST319775 (lexicon) OST125205 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18194
Vector Insertion
Chr 4: 73944539 - 73952868
Public Clones IST12361F9 (tigm)
Private Clones OST427778 (lexicon) OST59206 (lexicon) OST33895 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21113
Vector Insertion
Chr 4: 73952919 - 73957550
Public Clones not available
Private Clones OST340809 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1221
Vector Insertion
Chr 4: 73957655 - 73961415
Public Clones CE0024 (sanger)
Private Clones OST152236 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1074
Vector Insertion
Chr 4: 73961554 - 73976558
Public Clones CD0044 (sanger) CF0676 (sanger) XR0143 (sanger) AC0269 (sanger)
AN0894 (sanger) XR0144 (sanger) XB882 (baygenomics) IST14038C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6069
Vector Insertion
Chr 4: 73982895 - 73989273
Public Clones YHD145 (baygenomics) PST6948-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8906
Vector Insertion
Chr 4: 73989456 - 73991346
Public Clones XL057 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4905
Vector Insertion
Chr 4: 73994381 - 74003245
Public Clones AS0738 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1899
Vector Insertion
Chr 4: 74005433 - 74019469
Public Clones AY0368 (sanger) RRU513 (baygenomics) M120C12 (ggtc) M120B12 (ggtc)
IST12316A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4602
Vector Insertion
Chr 4: 74023533 - 74023705
Public Clones XP0308 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2284
Vector Insertion
Chr 4: 74045344 - 74050724
Public Clones AG0494 (sanger) XB470 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102835
Sequence
CGCCCGCGCCGCCTCCCGCCCACCTCCGAGCCGGGAGGGAGGGGAGCGCGGCGGAGGGATTCCGTGGTGGCGCCCCGTGCGCGTGCGCAGCGAACAGCTG

TCACCCAGTGCGGAACAAGTCTTCCAAAGATTCCCAAAACCCTCAGGGGAGGCCGCACTTTTCATCCCTTTCATTCGGGTGGCGTCTGGACCTCCGCCAG

CGGCGCAG - UNI8501 - - UNI16955 - AAACATCTGTGGCCATCATGGAGGTGGTGGAGGTGGAGAGTCCCCTAAATCCCAGCTGTAAGATAA

TGACCTTCAGACCTTCCATGGAGGAGTTTCGGGAGTTCAACAAATACCTCGCATACATGGAATCCAAAGGAGCCCATCGAGCAGGTCTTGCCAAG - UN

I1074 - - UNI1221 - - UNI1552 - - UNI16955 - - UNI18194 - - UNI20034 - - UNI21113 - - UNI21625 - TGC

ACTTGTCGGAATGACATGGTGAAGATATCAATGGATATATTTGTGAAGAAATTTCAGCCAGATAGATACCAGATTTGGAAACAAGGAAAGGATATATATA

CTATTGACCATACAAAGCCCACTCCAGAATCTACTCCAGAAGTAAAAACATGGCTACAGAGGAAGAAAAAATTAAGAAAGCCTCCCAAGAG CTTACAGG

GCAATAAGCCACTTTGTAAAAGGCCTAAACCTGAAGAAGATGAGGAATTTGCTGAATTTAGTGGGGAAGAGGGTGCAAACCCTGCCATGGGCCCTAGGCA

CCTCAAAGTCACTGAAAAGCCAGAAAAAGCATTAAAGCTGGGGAAATTAGAAGAATCTTCAGCAAAAGAAGCTTTGGATACCAGGATACAAGTGGATCAA

AGCTTACTGAACGACACCAAGCTCTCGG GAAAAGGTTGCATAAGTTCATCAGTAACAGCTGAAATTCCACCAGAAGACAACAGAGCCAGTGCTGTAATT

TCACCATCTCAGCTGAAGGAGGGCGCTGACTGCATACCACTTTCTCATGGCCATCAAGCAGGCAAAGAGTCACATCTACTTAAGATTCTAAAGCTTGAAT

CTCCCAAGATACCTTCCCCCCTGCCAGAAAGTAATAAAGTATTGACAGAGGGAGAAGAAAATGATGAAGAGGGCCATGGAAGTAACCTTGAGCCTGGGGA

AATCCCAGAAGCTCTTAGTGAAGAGAGAAATGGGCTCAACATTCCTAAG ATAATTGAAGGACAGCCAAAAACTACTAAGAGTTGGCGCCATCCACTTGG

TAAGCCTCCGGCCAGATCCCCAATGACACTTGTGAAGCAGCAGGTAGCGAGTGATGAAG - UNI6069 - AATTGCCTGAGGTTCTAAGCATTGACGA

AGAAGTTGAAGAAACAGAGTCTTGGGCAAAGCCTCTCATCCACCTTTGGCAGACAAAGTCTCCTAACTTTATGGCTGAACAGGAGTACAATGCAACTGTT

GCAAAAATGGAGCCAAACTGTGCCATCTGCACTCTGCTCATGCCGTACTACAAG - UNI8906 - CCTGATAGCAGCAAAGAAGAAAATGATTCTAGA

TGGGAGACAGCAGTAAATGAAGTGGTTCAATCTGGAAGAAAGACTAAGCCCATTATTCCAGAGATGTGTTTTATTTATAGTGAAGAAAATGTAGACTATT

CCCCCCCAAATGCCTTCCTTGAAGAAGATGGAACAAGTCTTCTGATTTCCTGTGCCAAGTGCTTCGTGCGGGTTCATGCAA GTTGTTATGGTGTCCCTT

CTCATGAAGTCTGTGATGGATGGCTGTGTGCCCGGTGCAAGAGAAATGCATGGACTGCA - UNI4905 - GAATGCTGTCTCTGCAATTTGAGGGGAG

GTGCTCTGAAACAGACTAAGAACAATCA GTGGGCTCATGTCATATGTGCTGTTGCAGTTCCAGAAGTGCGATTCACTAATGTCCCAGAACGGACACAAA

TAGATGTAGACAGAATACCTTTACAGAGGTTAAAATTG - UNI1899 - AAATGCATCTTCTGTAGACACCGGGTTAAAAAGGTTTCTGGAGCCTGCA

TCCAGTGTTCTTATGGCCGCTGCCCAGCTTCATTCCATGTTACGTGTGCCCATGCTGCTGGAGTGCTCATGGAGCCTGATGACTGGCCTTACGTGGTAAA

CATCACATGCTTCAGACATAGAGTCAACTCAAACGCG - UNI4602 - AAATCCAAAACTTGTGAGAAAGCCATTTCTGTGGGTCAGACAGTCATCAC

AAAACATCGAAACACTCGGTACTACAGCTGCAGAGTGATAGATGTGACATCTCAAACCTTCTATGAGGTCATGTTTGATGATGGCTCCTTCAGCAGAGAC

ACATTTCCTGAAGATATTGTG - UNI4602 - AGCCGAAACTGTGTGAAGCTGGGCCCTCCTGCGGAGGGAGAAGTCATCCAAGTCAAATGGCCTGAT

GGTAAACTCTATGGGGCAAAGTATCTTGGATCAAATGTTGCCTATATGTATCAG GTTGAATTTGAAGATGGATCGCAGATTGCAATGAAGAGAGAAGAC

ATATACACTTTAGATGAAGAGTTACCCAAGAGAGTAAAGGCTCGTTTT - UNI2284 - TCCACAGCCTCCGACATGCGATTTGAAGACACATTTTAT

GGAGCAGATGTAATCCAAGGGGAGAGGAAGAGGCAAAGAGTGCTAAGCTCCAGGCTCAAGAATGAGTATGTGGATGACCCTGTGTATCGTACTTTCCTGA

AGAGTTCTTTCCAGAAGAAGTGTCAGAAGAGACAGTAGTTGATAATGTGCAGCAGCCACAGTGCAGCTCAGACCAGAAGAGGGAAGACAAAGGGACAGCC

TTGGGGTACACATTGGGACAGGTGGCTGGGTGCTTCTTTGGTATTGGTAATAAACCAGGCTTCTGGAGTTTGATTACCAAGCAACCAAGAAGAGACATAT

TAGTTGCTTCTGTAATCTGATCACCCCTCAGTCATTTGTTTGACCCCAAAGAATATTCCTAAATTAAAGGAAACAGCAGTGAATGGCCCACTAGATAAAA

CAACTGCTAAAGAAGCGGGGTTCCCTCTCTGGCTCAGGTCCCTTCCTCAGGGAACACATTTGGAGGCTCCTTTCCCACCTCCTTCAGTGGCAGCCTCATC

ACCCAACAGCCGGTGGGTGTATTTATATATATTTTCCACAGCCAGGGAAAGAGTCTCACTCACATTTGTTTTCAGTGGCAGTTTTTATAAAACATTTTTA

AAACACAAATGGCATGTATGGTAATAGGATTTACCTGTATGCTATCTTCCCTTGTACAGAACTTTTCCATTTTTTATATTATTACTTTTGATTGTGTCTG

AAAACTGAGTTGGCCTTTATAAGAGGAAATTTTTTGCTCTTGAAGAGGAATTCATATGAAGTATATGGGAATTTTATATATTTACAGAGGAAAAATCTTG

GCCTGATATTTTGAACACTTCATAATTCCTGTTCTGAAATGATATTTATAAAATATATATTTCTTTCATTATGTGTTTGTAAAAATTAGAGTTTAAAGAA

ATATACTTAATGCATAGTTTTAAACTAATGTAACATGATTTTTCTTTGCAAAACAGCCTGGAGATGTATTAATATTTAAAAATTAAAATCTGTTTTCTCC

TG
Translation
 - UNI8501 - - UNI16955 - MEVVEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAK - UNI1074 - - UNI1221 - -

 UNI1552 - - UNI16955 - - UNI18194 - - UNI20034 - - UNI21113 - - UNI21625 - CTCRNDMVKISMDIFVKKFQPDRY

QIWKQGKDIYTIDHTKPTPESTPEVKTWLQRKKKLRKPPKS SLQGNKPLCKRPKPEEDEEFAEFSGEEGANPAMGPRH   - UNI6069 -  - UNI

8906 -   - UNI4905 -   - UNI1899 -  - UNI4602 -  - UNI4602 -   - UNI2284 - 
Transcript ENSMUST00000077851
Sequence
GATGAGGTCTACCTTGCTTAAATGTCTCTTTATCAGTACCAGGCTGCTTAATTAAGTGCATGAGGCAGACCGTGAATGGATGTCTACTGAGCCATTTACT

GAGTTAATGAATGAAGGATTATCAAGTATGTGCATCATCAATCC - UNI8501 - - UNI16955 - - UNI36038 - AAACATCTGTGGCCATC

ATGGAGGTGGTGGAGGTGGAGAGTCCCCTAAATCCCAGCTGTAAGATAATGACCTTCAGACCTTCCATGGAGGAGTTTCGGGAGTTCAACAAATACCTCG

CATACATGGAATCCAAAGGAGCCCATCGAGCAGGTCTTGCCAAG - UNI1552 - - UNI16955 - GTGATTCCTCCTAAGGAGTGGAAGCCAAGA

CAGTGCTATGATGATATTGATAATTTGCTCATCCCAGCACCAATTCAGCAGATGGTCACAGGGCAGTCGGGACTGTTCACGCAATACAACATCCAGAAGA

AAGCCATGACTGTGAAGGAGTTCAGGCAGCTGGCTAACAGCAGCAA - UNI20034 - ATACTGTACTCCAAGATACTTGGATTATGAAGATTTGGAA

CGCAAATACTGGAAAAACTTAACTTTTGTGGCACCTATTTATGGAGCAGATATAAATGGGAGCATTTATGATGAG - UNI21625 - GGTGTGGATGA

ATGGAATATAGCTCGCCTAAATACAGTCTTGGATGTGGTTGAAGAAGAGTGTGGTATTTCTATTGAGGGGGTAAATACCCCTTATCTCTATTTTGGAATG

TGGAAAACAACATTTGCGTGGCACACGGAGGACATGGATCTCTACAGTATTAATTATCTCCACTTTGGGGAGCCCAAGTCTTG - UNI18194 - GTA

TGCTATACCTCCGGAGCATGGAAAGCGACTTGAAAGACTAGCCCAAG - UNI21113 - GCTTCTTCCCCAGTAGCTCCCAAGGCTGTGATGCATTTC

TCCGGCACAAGATGACCCTCATTTCCCCCTCAGTGCTGAAGAAGTATGGCATTCCCTTCGACAAG - UNI1221 - ATCACCCAGGAGGCTGGAGAGT

TTATGATCACTTTTCCTTATGGATATCATGCTGGTTTTAATCATGGTTTCAATTGTGCTGAGTCTACAAATTTTGCTACAGTCAGATGGATTGACTACGG

CAAGGTTGCTAAGTTG - UNI1074 - TGCACTTGTCGGAATGACATGGTGAAGATATCAATGGATATATTTGTGAAGAAATTTCAGCCAGATAGATA

CCAGATTTGGAAACAAGGAAAGGATATATATACTATTGACCATACAAAGCCCACTCCAGAATCTACTCCAGAAGTAAAAACATGGCTACAGAGGAAGAAA

AAATTAAGAAAGCCTCCCAAGAG CTTACAGGGCAATAAGCCACTTTGTAAAAGGCCTAAACCTGAAGAAGATGAGGAATTTGCTGAATTTAGTGGGGAA

GAGGGTGCAAACCCTGCCATGGGCCCTAGGCACCTCAAAGTCACTGAAAAGCCAGAAAAAGCATTAAAGCTGGGGAAATTAGAAGAATCTTCAGCAAAAG

AAGCTTTGGATACCAGGATACAAGTGGATCAAAGCTTACTGAACGACACCAAGCTCTCGG GAAAAGGTTGCATAAGTTCATCAGTAACAGCTGAAATTC

CACCAGAAGACAACAGAGCCAGTGCTGTAATTTCACCATCTCAGCTGAAGGAGGGCGCTGACTGCATACCACTTTCTCATGGCCATCAAGCAGGCAAAGA

GTCACATCTACTTAAGATTCTAAAGCTTGAATCTCCCAAGATACCTTCCCCCCTGCCAGAAAGTAATAAAGTATTGACAGAGGGAGAAGAAAATGATGAA

GAGGGCCATGGAAGTAACCTTGAGCCTGGGGAAATCCCAGAAGCTCTTAGTGAAGAGAGAAATGGGCTCAACATTCCTAAG ATAATTGAAGGACAGCCA

AAAACTACTAAGAGTTGGCGCCATCCACTTGGTAAGCCTCCGGCCAGATCCCCAATGACACTTGTGAAGCAGCAGGTAGCGAGTGATGAAG - UNI606

9 - AATTGCCTGAGGTTCTAAGCATTGACGAAGAAGTTGAAGAAACAGAGTCTTGGGCAAAGCCTCTCATCCACCTTTGGCAGACAAAGTCTCCTAACT

TTATGGCTGAACAGGAGTACAATGCAACTGTTGCAAAAATGGAGCCAAACTGTGCCATCTGCACTCTGCTCATGCCGTACTACAAG - UNI8906 - C

CTGATAGCAGCAAAGAAGAAAATGATTCTAGATGGGAGACAGCAGTAAATGAAGTGGTTCAATCTGGAAGAAAGACTAAGCCCATTATTCCAGAGATGTG

TTTTATTTATAGTGAAGAAAATGTAGACTATTCCCCCCCAAATGCCTTCCTTGAAGAAGATGGAACAAGTCTTCTGATTTCCTGTGCCAAGTGCTTCGTG

CGGGTTCATGCAA GTTGTTATGGTGTCCCTTCTCATGAAGTCTGTGATGGATGGCTGTGTGCCCGGTGCAAGAGAAATGCATGGACTGCA - UNI490

5 - GAATGCTGTCTCTGCAATTTGAGGGGAGGTGCTCTGAAACAGACTAAGAACAATCA GTGGGCTCATGTCATATGTGCTGTTGCAGTTCCAGAAGT

GCGATTCACTAATGTCCCAGAACGGACACAAATAGATGTAGACAGAATACCTTTACAGAGGTTAAAATTG - UNI1899 - AAATGCATCTTCTGTAG

ACACCGGGTTAAAAAGGTTTCTGGAGCCTGCATCCAGTGTTCTTATGGCCGCTGCCCAGCTTCATTCCATGTTACGTGTGCCCATGCTGCTGGAGTGCTC

ATGGAGCCTGATGACTGGCCTTACGTGGTAAACATCACATGCTTCAGACATAGAGTCAACTCAAACGCG - UNI4602 - AAATCCAAAACTTGTGAG

AAAGCCATTTCTGTGGGTCAGACAGTCATCACAAAACATCGAAACACTCGGTACTACAGCTGCAGAGTGATAGATGTGACATCTCAAACCTTCTATGAGG

TCATGTTTGATGATGGCTCCTTCAGCAGAGACACATTTCCTGAAGATATTGTG - UNI4602 - AGCCGAAACTGTGTGAAGCTGGGCCCTCCTGCGG

AGGGAGAAGTCATCCAAGTCAAATGGCCTGATGGTAAACTCTATGGGGCAAAGTATCTTGGATCAAATGTTGCCTATATGTATCAG GTTGAATTTGAAG

ATGGATCGCAGATTGCAATGAAGAGAGAAGACATATACACTTTAGATGAAGAGTTACCCAAGAGAGTAAAGGCTCGTTTT - UNI2284 - TCCACAG

CCTCCGACATGCGATTTGAAGACACATTTTATGGAGCAGATGTAATCCAAGGGGAGAGGAAGAGGCAAAGAGTGCTAAGCTCCAGGCTCAAGAATGAGTA

TGTGGATGACCCTGTGTATCGTACTTTCCTGAAGAGTTCTTTCCAGAAGAAGTGTCAGAAGAGACAGTAGTTGATAATGTGCAGCAGCCACAGTGCAGCT

CAGACCAGAAGAGGGAAGACAAAGGGACAGCCTTGGGGTACACATTGGGACAGGTGGCTGGGTGCTTCTTTGGTATTGGTAATAAACCAGGCTTCTGGAG

TTTGATTACCAAGCAACCAAGAAGAGACATATTAGTTGCTTCTGTAATCTGATCACCCCTCAGTCATTTGTTTGACCCCAAAGAATATTCCTAAATTAAA

GGAAACAGCAGTGAATGGCCCACTAGATAAAACAACTGCTAAAGAAGCGGGGTTCCCTCTCTGGCTCAGGTCCCTTCCTCAGGGAACACATTTGGAGGCT

CCTTTCCCACCTCCTTCAGTGGCAGCCTCATCACCCAACAGCCGGTGGGTGTATTTATATATATTTTCCACAGCCAGGGAAAGAGTCTCACTCACATTTG

TTTTCAGTGGCAGTTTTTATAAAACATTTTTAAAACACAAATGGCATGTATGGTAATAGGATTTACCTGTATGCTATCTTCCCTTGTACAGAACTTTTCC

ATTTTTTATATTATTACTTTTGATTGTGTCTGAAAACTGAGTTGGCCTTTATAAGAGGAAATTTTTTGCTCTTGAAGAGGAATTCATATGAAGTATATGG

GAATTTTATATATTTACAGAGGAAAAATCTTGGCCTGATATTTTGAACACTTCATAATTCCTGTTCTGAAATGATATTTATAAAATATATATTTCTTTCA

TTATGTGTTTGTAAAAATTAGAGTTTAAAGAAATATACTTAATGCATAGTTTTAAACTAATGTAACATGATTTTTCTTTGCAAAACAGCCTGGAGATGTA

TTAATATTTAAAAATTAAAATCTGTTTTCTCCT
Translation
 - UNI8501 - - UNI16955 - - UNI36038 - MEVVEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAK - UNI1552 - 

- UNI16955 - VIPPKEWKPRQCYDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSSK - UNI20034 - KYCTPRYLDYEDLE

RKYWKNLTFVAPIYGADINGSIYDE - UNI21625 - GVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGE

PKSW - UNI18194 - WYAIPPEHGKRLERLAQG - UNI21113 - GFFPSSSQGCDAFLRHKMTLISPSVLKKYGIPFDK - UNI1221 - IT

QEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWIDYGKVAKL - UNI1074 - CTCRNDMVKISMDIFVKKFQPDRYQIWKQGKDIYTIDHTKPTP

ESTPEVKTWLQRKKKLRKPPKS SLQGNKPLCKRPKPEEDEEFAEFSGEEGANPAMGPRHLKVTEKPEKALKLGKLEESSAKEALDTRIQVDQSLLNDTK

LSG GKGCISSSVTAEIPPEDNRASAVISPSQLKEGADCIPLSHGHQAGKESHLLKILKLESPKIPSPLPESNKVLTEGEENDEEGHGSNLEPGEIPEAL

SEERNGLNIPK IIEGQPKTTKSWRHPLGKPPARSPMTLVKQQVASDEE - UNI6069 - ELPEVLSIDEEVEETESWAKPLIHLWQTKSPNFMAEQE

YNATVAKMEPNCAICTLLMPYYK - UNI8906 - PDSSKEENDSRWETAVNEVVQSGRKTKPIIPEMCFIYSEENVDYSPPNAFLEEDGTSLLISCAK

CFVRVHAS SCYGVPSHEVCDGWLCARCKRNAWTA - UNI4905 - ECCLCNLRGGALKQTKNNQ QWAHVICAVAVPEVRFTNVPERTQIDVDRIPL

QRLKL - UNI1899 - KCIFCRHRVKKVSGACIQCSYGRCPASFHVTCAHAAGVLMEPDDWPYVVNITCFRHRVNSNA - UNI4602 - KSKTCEK

AISVGQTVITKHRNTRYYSCRVIDVTSQTFYEVMFDDGSFSRDTFPEDIV - UNI4602 - SRNCVKLGPPAEGEVIQVKWPDGKLYGAKYLGSNVAY

MYQ VEFEDGSQIAMKREDIYTLDEELPKRVKARF - UNI2284 - STASDMRFEDTFYGADVIQGERKRQRVLSSRLKNEYVDDPVYRTFLKSSFQK

KCQKRQ
Transcript ENSMUST00000030102
Sequence
CGCCCGCGCCGCCTCCCGCCCACCTCCGAGCCGGGAGGGAGGGGAGCGCGGCGGAGGGATTCCGTGGTGGCGCCCCGTGCGCGTGCGCAGCGAACAGCTG

TCACCCAGTGCGGAACAAGTCTTCCAAAGATTCCCAAAACCCTCAGGGGAGGCCGCACTTTTCATCCCTTTCATTCGGGTGGCGTCTGGACCTCCGCCAG

CGGCGCAG - UNI8501 - - UNI16955 - AAACATCTGTGGCCATCATGGAGGTGGTGGAGGTGGAGAGTCCCCTAAATCCCAGCTGTAAGATAA

TGACCTTCAGACCTTCCATGGAGGAGTTTCGGGAGTTCAACAAATACCTCGCATACATGGAATCCAAAGGAGCCCATCGAGCAGGTCTTGCCAAG - UN

I1552 - - UNI16955 - GTGATTCCTCCTAAGGAGTGGAAGCCAAGACAGTGCTATGATGATATTGATAATTTGCTCATCCCAGCACCAATTCAGC

AGATGGTCACAGGGCAGTCGGGACTGTTCACGCAATACAACATCCAGAAGAAAGCCATGACTGTGAAGGAGTTCAGGCAGCTGGCTAACAGCAGCAA - 

UNI20034 - ATACTGTACTCCAAGATACTTGGATTATGAAGATTTGGAACGCAAATACTGGAAAAACTTAACTTTTGTGGCACCTATTTATGGAGCAG

ATATAAATGGGAGCATTTATGATGAG - UNI21625 - GGTGTGGATGAATGGAATATAGCTCGCCTAAATACAGTCTTGGATGTGGTTGAAGAAGAG

TGTGGTATTTCTATTGAGGGGGTAAATACCCCTTATCTCTATTTTGGAATGTGGAAAACAACATTTGCGTGGCACACGGAGGACATGGATCTCTACAGTA

TTAATTATCTCCACTTTGGGGAGCCCAAGTCTTG - UNI18194 - GTATGCTATACCTCCGGAGCATGGAAAGCGACTTGAAAGACTAGCCCAAG -

 UNI21113 - GCTTCTTCCCCAGTAGCTCCCAAGGCTGTGATGCATTTCTCCGGCACAAGATGACCCTCATTTCCCCCTCAGTGCTGAAGAAGTATGG

CATTCCCTTCGACAAG - UNI1221 - ATCACCCAGGAGGCTGGAGAGTTTATGATCACTTTTCCTTATGGATATCATGCTGGTTTTAATCATGGTTT

CAATTGTGCTGAGTCTACAAATTTTGCTACAGTCAGATGGATTGACTACGGCAAGGTTGCTAAGTTG - UNI1074 - TGCACTTGTCGGAATGACAT

GGTGAAGATATCAATGGATATATTTGTGAAGAAATTTCAGCCAGATAGATACCAGATTTGGAAACAAGGAAAGGATATATATACTATTGACCATACAAAG

CCCACTCCAGAATCTACTCCAGAAGTAAAAACATGGCTACAGAGGAAGAAAAAATTAAGAAAGCCTCCCAAGAG CTTACAGGGCAATAAGCCACTTTGT

AAAAGGCCTAAACCTGAAGAAGATGAGGAATTTGCTGAATTTAGTGGGGAAGAGGGTGCAAACCCTGCCATGGGCCCTAGGCACCTCAAAGTCACTGAAA

AGCCAGAAAAAGCATTAAAGCTGGGGAAATTAGAAGAATCTTCAGCAAAAGAAGCTTTGGATACCAGGATACAAGTGGATCAAAGCTTACTGAACGACAC

CAAGCTCTCGG GAAAAGGTTGCATAAGTTCATCAGTAACAGCTGAAATTCCACCAGAAGACAACAGAGCCAGTGCTGTAATTTCACCATCTCAGCTGAA

GGAGGGCGCTGACTGCATACCACTTTCTCATGGCCATCAAGCAGGCAAAGAGTCACATCTACTTAAGATTCTAAAGCTTGAATCTCCCAAGATACCTTCC

CCCCTGCCAGAAAGTAATAAAGTATTGACAGAGGGAGAAGAAAATGATGAAGAGGGCCATGGAAGTAACCTTGAGCCTGGGGAAATCCCAGAAGCTCTTA

GTGAAGAGAGAAATGGGCTCAACATTCCTAAG ATAATTGAAGGACAGCCAAAAACTACTAAGAGTTGGCGCCATCCACTTGGTAAGCCTCCGGCCAGAT

CCCCAATGACACTTGTGAAGCAGCAGGTAGCGAGTGATGAAG - UNI6069 - AATTGCCTGAGGTTCTAAGCATTGACGAAGAAGTTGAAGAAACAG

AGTCTTGGGCAAAGCCTCTCATCCACCTTTGGCAGACAAAGTCTCCTAACTTTATGGCTGAACAGGAGTACAATGCAACTGTTGCAAAAATGGAGCCAAA

CTGTGCCATCTGCACTCTGCTCATGCCGTACTACAAG - UNI8906 - CCTGATAGCAGCAAAGAAGAAAATGATTCTAGATGGGAGACAGCAGTAAA

TGAAGTGGTTCAATCTGGAAGAAAGACTAAGCCCATTATTCCAGAGATGTGTTTTATTTATAGTGAAGAAAATGTAGACTATTCCCCCCCAAATGCCTTC

CTTGAAGAAGATGGAACAAGTCTTCTGATTTCCTGTGCCAAGTGCTTCGTGCGGGTTCATGCAA GTTGTTATGGTGTCCCTTCTCATGAAGTCTGTGAT

GGATGGCTGTGTGCCCGGTGCAAGAGAAATGCATGGACTGCA - UNI4905 - GAATGCTGTCTCTGCAATTTGAGGGGAGGTGCTCTGAAACAGACT

AAGAACAATCA GTGGGCTCATGTCATATGTGCTGTTGCAGTTCCAGAAGTGCGATTCACTAATGTCCCAGAACGGACACAAATAGATGTAGACAGAATA

CCTTTACAGAGGTTAAAATTG - UNI1899 - AAATGCATCTTCTGTAGACACCGGGTTAAAAAGGTTTCTGGAGCCTGCATCCAGTGTTCTTATGGC

CGCTGCCCAGCTTCATTCCATGTTACGTGTGCCCATGCTGCTGGAGTGCTCATGGAGCCTGATGACTGGCCTTACGTGGTAAACATCACATGCTTCAGAC

ATAGAGTCAACTCAAACGCG - UNI4602 - AAATCCAAAACTTGTGAGAAAGCCATTTCTGTGGGTCAGACAGTCATCACAAAACATCGAAACACTC

GGTACTACAGCTGCAGAGTGATAGATGTGACATCTCAAACCTTCTATGAGGTCATGTTTGATGATGGCTCCTTCAGCAGAGACACATTTCCTGAAGATAT

TGTG - UNI4602 - AGCCGAAACTGTGTGAAGCTGGGCCCTCCTGCGGAGGGAGAAGTCATCCAAGTCAAATGGCCTGATGGTAAACTCTATGGGGC

AAAGTATCTTGGATCAAATGTTGCCTATATGTATCAG GTTGAATTTGAAGATGGATCGCAGATTGCAATGAAGAGAGAAGACATATACACTTTAGATGA

AGAGTTACCCAAGAGAGTAAAGGCTCGTTTT - UNI2284 - TCCACAGCCTCCGACATGCGATTTGAAGACACATTTTATGGAGCAGATGTAATCCA

AGGGGAGAGGAAGAGGCAAAGAGTGCTAAGCTCCAGGCTCAAGAATGAGTATGTGGATGACCCTGTGTATCGTACTTTCCTGAAGAGTTCTTTCCAGAAG

AAGTGTCAGAAGAGACAGTAGTTGATAATGTGCAGCAGCCACAGTGCAGCTCAGACCAGAAGAGGGAAGACAAAGGGACAGCCTTGGGGTACACATTGGG

ACAGGTGGCTGGGTGCTTCTTTGGTATTGGTAATAAACCAGGCTTCTGGAGTTTGATTACCAAGCAACCAAGAAGAGACATATTAGTTGCTTCTGTAATC

TGATCACCCCTCAGTCATTTGTTTGACCCCAAAGAATATTCCTAAATTAAAGGAAACAGCAGTGAATGGCCCACTAGATAAAACAACTGCTAAAGAAGCG

GGGTTCCCTCTCTGGCTCAGGTCCCTTCCTCAGGGAACACATTTGGAGGCTCCTTTCCCACCTCCTTCAGTGGCAGCCTCATCACCCAACAGCCGGTGGG

TGTATTTATATATATTTTCCACAGCCAGGGAAAGAGTCTCACTCACATTTGTTTTCAGTGGCAGTTTTTATAAAACATTTTTAAAACACAAATGGCATGT

ATGGTAATAGGATTTACCTGTATGCTATCTTCCCTTGTACAGAACTTTTCCATTTTTTATATTATTACTTTTGATTGTGTCTGAAAACTGAGTTGGCCTT

TATAAGAGGAAATTTTTTGCTCTTGAAGAGGAATTCATATGAAGTATATGGGAATTTTATATATTTACAGAGGAAAAATCTTGGCCTGATATTTTGAACA

CTTCATAATTCCTGTTCTGAAATGATATTTATAAAATATATATTTCTTTCATTATGTGTTTGTAAAAATTAGAGTTTAAAGAAATATACTTAATGCATAG

TTTTAAACTAATGTAACATGATTTTTCTTTGCAAAACAGCCTGGAGATGTATTAATATTTAAAAATTAAAATCTGTTTTCTCCTG
Translation
 - UNI8501 - - UNI16955 - MEVVEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAK - UNI1552 - - UNI16955 - 

VIPPKEWKPRQCYDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSSK - UNI20034 - KYCTPRYLDYEDLERKYWKNLTFVAPI

YGADINGSIYDE - UNI21625 - GVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSW - UNI181

94 - WYAIPPEHGKRLERLAQG - UNI21113 - GFFPSSSQGCDAFLRHKMTLISPSVLKKYGIPFDK - UNI1221 - ITQEAGEFMITFPYG

YHAGFNHGFNCAESTNFATVRWIDYGKVAKL - UNI1074 - CTCRNDMVKISMDIFVKKFQPDRYQIWKQGKDIYTIDHTKPTPESTPEVKTWLQRK

KKLRKPPKS SLQGNKPLCKRPKPEEDEEFAEFSGEEGANPAMGPRHLKVTEKPEKALKLGKLEESSAKEALDTRIQVDQSLLNDTKLSG GKGCISSSV

TAEIPPEDNRASAVISPSQLKEGADCIPLSHGHQAGKESHLLKILKLESPKIPSPLPESNKVLTEGEENDEEGHGSNLEPGEIPEALSEERNGLNIPK I

IEGQPKTTKSWRHPLGKPPARSPMTLVKQQVASDEE - UNI6069 - ELPEVLSIDEEVEETESWAKPLIHLWQTKSPNFMAEQEYNATVAKMEPNCA

ICTLLMPYYK - UNI8906 - PDSSKEENDSRWETAVNEVVQSGRKTKPIIPEMCFIYSEENVDYSPPNAFLEEDGTSLLISCAKCFVRVHAS SCYG

VPSHEVCDGWLCARCKRNAWTA - UNI4905 - ECCLCNLRGGALKQTKNNQ QWAHVICAVAVPEVRFTNVPERTQIDVDRIPLQRLKL - UNI18

99 - KCIFCRHRVKKVSGACIQCSYGRCPASFHVTCAHAAGVLMEPDDWPYVVNITCFRHRVNSNA - UNI4602 - KSKTCEKAISVGQTVITKHR

NTRYYSCRVIDVTSQTFYEVMFDDGSFSRDTFPEDIV - UNI4602 - SRNCVKLGPPAEGEVIQVKWPDGKLYGAKYLGSNVAYMYQ VEFEDGSQI

AMKREDIYTLDEELPKRVKARF - UNI2284 - STASDMRFEDTFYGADVIQGERKRQRVLSSRLKNEYVDDPVYRTFLKSSFQKKCQKRQ

For any suggestions or comments, please send an email to unitrap@crg.es