Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028403 (Zdhhc21)
Chromosomal location
Chr 4: 82450856 - 82505862 (-)
Description
zinc finger, DHHC domain containing 21 Gene [Source:MGI (curated);Acc:Zdhhc21-001]
RefSeq_dna
NM_026647 
RefSeq_peptide
NP_080923.2 
UniGene
Mm.475153 
MGI
MGI:1915518 
Uniprot/SWISSPROT
Q9D270 
Uniprot/SPTREMBL
Q5SRN8 Q5SRP0 
Human Ortholog
ENSG00000175893 (ZDHHC21)
Omim not available
UniTrap UNI26440
Vector Insertion
Chr 4: 82500020 - 82505393
Public Clones not available
Private Clones OST117985 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34597
Vector Insertion
Chr 4: 82452916 - 82466351
Public Clones IST13597D3 (tigm) IST13760H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107239
Sequence
CCAGAAGATGTCAATGTTGCAGACTAAATTTTGAAGCAAG - UNI26440 - GTACTCACAGAGAACTGGTATTGAAGGGAGGCCCATACGATGGAAT

ATGAAATATAAAGAAATAAATAAAAGAATGACTCAAGAAGATAGCACTTCTAAATGCAAGTGCCAGAAAAATCACAGTTCATCTCAGTGAATTTGCAAGT

G GATTGTCTTGCCTGTGGGCGGCAGGCGGGTACAGGACTGCAGAATGGGTCTTCGGATTCACTTTGTTGTTGACCCGCATGGTTGGTGCTGCATGGGCT

TGATTGTCTTTGTCTGGTTATACAATATTGTTATAATTCCCAAAATTGTCCTCTTTCCTCACTATGAAGAAGGACATATTCCTGGCATTTTAATAATAA 

TATTCTATGGCATTTCCATATTTTGCCTGGTTGCCTTAGTGAGGGCCTCCTTAACTGATCCTGGAAGACTCCCTGAAAATCCCAAGATCCCACATGCAG 

AGCGGGAGCTGTGGGAGCTCTGCAACAAGTGCAACCTGATGAGGCCGAAGCGCTCCCACCACTGCAGCCGCTGCGGCCACTGCGTCAGGAGGATGGACCA

TCACTGTCCTTG GATAAACAATTGTGTGGGTGAAGACAACCATTGGCTCTTTCTGCAGTTGTGTTTCTACACTGAGCTGCTTACTTGCTACGCACTGAT

GTTTTCTTTCTGCCATTATTATTATTTTCTTCCACTAAAAAAGCGTAACTTG - UNI34597 - GATCTCTTTGTTGTTCGCCATGAGCTGGCTATCA

TGAGACTAGCTGCCTTCATGGGCATCACTATGTTAGTTGGAATAACTGGACTCTTCTATACACAACTGATTGGCATCATCACA - UNI34597 - GAT

ACAACATCTATTGAAAAAATGTCAAATTGTTGTGAAGAAAT - UNI34597 - ATCGCGGCCCCGAAAGCCATGGCAGCAGACCTTCTCAGAAGTTTT

TGGCACTCGTTGGAAGATCCTGTGGTTCATTCCTTTCAGGCAGCGGCAACCACTGCGAGTTCCCTACCACTTTGCCAATCACGTCTAAACAGATGGATGG

TGGGCACAGATGGGTCCTCCATGCTGGAAATGCGTTACAGGTTTTATGAGAATAGAACTATGACAGTCTTCAAGTCAATTAAAATCCACCTACCAATCTT

AGGCATCA
Translation
 - UNI26440 -  MGLRIHFVVDPHGWCCMGLIVFVWLYNIVIIPKIVLFPHYEEGHIPGILIII IFYGISIFCLVALVRASLTDPGRLPENPKIPH

AE ERELWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPW WINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNL - UNI34597

 - DLFVVRHELAIMRLAAFMGITMLVGITGLFYTQLIGIIT - UNI34597 - DTTSIEKMSNCCEEI - UNI34597 - ISRPRKPWQQTFSEV

FGTRWKILWFIPFRQRQPLRVPYHFANHV
Transcript ENSMUST00000030110
Sequence
GGCCTGGGCGGCGGAGGCGCGGAGCCGAGTGGAAAGCGGCGGAGCGGGCGGCG - UNI26440 - GTACTCACAGAGAACTGGTATTGAAGGGAGGCC

CATACGATGGAATATGAAATATAAAGAAATAAATAAAAGAATGACTCAAGAAGATAGCACTTCTAAATGCAAGTGCCAGAAAAATCACAGTTCATCTCAG

TGAATTTGCAAGTG GATTGTCTTGCCTGTGGGCGGCAGGCGGGTACAGGACTGCAGAATGGGTCTTCGGATTCACTTTGTTGTTGACCCGCATGGTTGG

TGCTGCATGGGCTTGATTGTCTTTGTCTGGTTATACAATATTGTTATAATTCCCAAAATTGTCCTCTTTCCTCACTATGAAGAAGGACATATTCCTGGCA

TTTTAATAATAA TATTCTATGGCATTTCCATATTTTGCCTGGTTGCCTTAGTGAGGGCCTCCTTAACTGATCCTGGAAGACTCCCTGAAAATCCCAAGA

TCCCACATGCAG AGCGGGAGCTGTGGGAGCTCTGCAACAAGTGCAACCTGATGAGGCCGAAGCGCTCCCACCACTGCAGCCGCTGCGGCCACTGCGTCA

GGAGGATGGACCATCACTGTCCTTG GATAAACAATTGTGTGGGTGAAGACAACCATTGGCTCTTTCTGCAGTTGTGTTTCTACACTGAGCTGCTTACTT

GCTACGCACTGATGTTTTCTTTCTGCCATTATTATTATTTTCTTCCACTAAAAAAGCGTAACTTG - UNI34597 - GATCTCTTTGTTGTTCGCCAT

GAGCTGGCTATCATGAGACTAGCTGCCTTCATGGGCATCACTATGTTAGTTGGAATAACTGGACTCTTCTATACACAACTGATTGGCATCATCACA - U

NI34597 - GATACAACATCTATTGAAAAAATGTCAAATTGTTGTGAAGAAAT - UNI34597 - ATCGCGGCCCCGAAAGCCATGGCAGCAGACCT

TCTCAGAAGTTTTTGGCACTCGTTGGAAGATCCTGTGGTTCATTCCTTTCAGGCAGCGGCAACCACTGCGAGTTCCCTACCACTTTGCCAATCACGTCTA

AACAGATGGATGGTGGGCACAGATGGGTCCTCCATGCTGGAAATGCGTTACAGGTTTTATGAGAATAGAACTATGACAGTCTTCAAGTCAATTAAAATCC

ACCTACCAATCTTAGGCATCATAATGTGCCCCAGGCTTCATTTTAATAGTGATCTTGATCCTGTTGTGGGACTAATACAAGATCTATATTTAAGTTTTAA

AAGCATGTTTACTTTTAAATTAGCCTTCCACCAGGGTTTCTTTAAATGCGTTTGTTACTAAACTCAGAAGGCAGTGATTGGGATGAAACAATTGTACATA

CATTTTCTTCAGTACTCAAAGTTTTTTAAATTTTAATTTATAGGAAATTTGACATGTTTTATGTTTACCTTTAAGCAGTCCTAACCAAATCTGAATTTAA

TTCTTCAAGTTTACAAAACTGGATACACTTTGTTATGTATAAGTTAAAATGTTACTACTTGCTTTTATATGTGCTGTAGGCTTTTACAGTGCAGTGAGCA

ACAAGGGGCAGTGCCTGGCTAGGAGCAGCTCTCTGATGCCCTTCTTTCTCCTTCTCAAAACCACAGACGACTCCCCGAGTGTAGTGCACCAACTACTACC

TTACTGTGAGGGAAAAACTATGTTTCCCTTCTGCTGCAATCACTGATTGCTTTTAGAATATTTGCTCCCAGGAGAAATGTGTGACCAGTCAGGTTTATAT

TCCTGTTTTACCCTAAGATTCTAATGACTGAAGAGGGTAGGAAGTTTGCAATAATTCCAGTTACTTCTTCAAGTGCAGTTATATTAGAAAGCAGATGTTT

TAAAGTGCTAAGCTGAATGGTGTGTAACAGTGTAAGGAGGAGAACTGTGCTTTTAAAGTATGGATACTTTTATTTATCTGCCATTAGATCTCACTGTACA

CATTGAAGATTTATATATTATAGAATCGATACTGGTCAACTCATATCAAAGTGTAAAAGTGGGTCACTAAATTTATATACCAGTAATCACCCAAGTTGAA

ATTGAATTTCCACTTGTAATTCGCATCACTCTAGAGACCTTTTATTAATGTCAGGAAATTACTGTAAAATAGAATGATCTATGGTAGTGATGGTCTCTTA

ACAAACATGAGCCTTTTGTATACAAAGACATTTTGTATGATTTAATTTTTTTCATTTAGAATACTGCAATTCCATATGTTTGTGTGCTTAGTAATCTTTT

CCCTGAAAAGAGTATTGAACAAATCTACCATTTGTGAACCATCTACATACTTTTCTTATAAGTAGTTGTAAAGTAAGGAATCATAGCTGGGAAATACTGT

GGCTAGTTCTTTCAGATACTGTAAATGTCTTATAAAATATTCTGAATAGAATAATCTCTTTGCAGAAATATTAATACC
Translation
 - UNI26440 -  MGLRIHFVVDPHGWCCMGLIVFVWLYNIVIIPKIVLFPHYEEGHIPGILIII IFYGISIFCLVALVRASLTDPGRLPENPKIPH

AE ERELWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPW WINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNL - UNI34597

 - DLFVVRHELAIMRLAAFMGITMLVGITGLFYTQLIGIIT - UNI34597 - DTTSIEKMSNCCEEI - UNI34597 - ISRPRKPWQQTFSEV

FGTRWKILWFIPFRQRQPLRVPYHFANHV

For any suggestions or comments, please send an email to unitrap@crg.es