Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028416 (Bag1)
Chromosomal location
Chr 4: 40883431 - 40895314 (-)
Description
BCL2-associated athanogene 1 Gene [Source:MGI (curated);Acc:Bag1-001]
RefSeq_dna
NM_009736 
RefSeq_peptide
NP_033866.4 
UniGene
Mm.688 
MGI
MGI:108047 
Uniprot/SWISSPROT
Q60739 
Uniprot/SPTREMBL
Q9CUY1 Q9D7K6 Q6IS45 
Human Ortholog
ENSG00000107262 (BAG1)
Omim not available
UniTrap UNI27093
Vector Insertion
Chr 4: 40894754 - 40895265
Public Clones not available
Private Clones OST71812 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37826
Vector Insertion
Chr 4: 40893201 - 40895265
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI490
Vector Insertion
Chr 4: 40888672 - 40890657
Public Clones CJ0412 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13748
Vector Insertion
Chr 4: 40886218 - 40888557
Public Clones CMHD-GT_258D5-3 (cmhd) CMHD-GT_258C04-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108089
Sequence
GGCGGAACTGGTGAGTAGTGGGGCGGGGTTGCAAGGCTGCGCGCCCGGTAGCCACCGCTGCGCTGTGAACAAACGCGGCCTGGCGGGTCGCAGCGCCGCG

CGGCGACCGCGAGGCGACCGGGAGCCGCTGGGACCCAGGCTGCGCGCCCCTCGGCCTGCCCGGGAGCCGCGCCAGTCGGAGTCCCGGGCCGAGCGGGGCT

TGCCTCCCTCTCAGCGTTCCTCTGTGCGCAGTGCAGCCAGCGGGCATGACCGATCCACCAGGGGCGCCGCCGCCGGCGCCTGCAAGCCGCGGGTGAAGAA

GAAAGTCCGGCCCCGCTCTTCTCAGAGCGAGAAGGTAGGGAGCAGCAGCAGGGAGTTGACTAGAAGTAAGAAAGTGACCCGTAGCAAGAACGTGACCGGG

ACCCAGGTAGAGGAGGTGACCAAGATCGAGGAGGCGACCCAAACCGAGGAAGTAACTGTGGCAGAAGAGGTGACCCAGACCGACAACATGGCCAAGACCG

AGGAGATGGTCCAGACGGAGGAAATGGAAACACCCAGACTCAGCGTGATCGTCACCCACA - UNI27093 - GCAATGAGAGGTATGACCTTCTTGTT

ACCCCACAGCAAGGTAACAGTGAGCCAGTTGTCCAAGACTTGGCTCAGCTTGTTGAAGAGGCCACAGGAGTTCCACTACCTTTTCAGAAGCTCATATTTA

AGG GAAAATCTCTGAAAGAAATGGAAACACCGTTGTCAGCACTTGGAATGCAAAATGGTTGCCGAGTCATGTTAATTGGTGAAAAG - UNI490 - A

GCAATCCAGAAGAAGAGGTTGAGTTAAAGAAGCTGAAAGATTTGGAGGTATCTGCAGAGAAGATAGCTAACCACCTGCAAGAATTGAATAAAGAGCTTTC

TGGCATCCAGCAG - UNI13748 - GGTTTTCTGGCTAAGGAATTGCAAGCGGAGGCTCTCTGCAAACTTGATAGGAAAGTAAAAGCAACAATTGAGC

AATTCATGAAGATCTTGGAGGAGATTGACACAATG GTCCTACCAGAACAATTTAAAGACAGCAGGCTAAAAAGGAAGAATTTGGTGAAAAAGGTTCAG 

GTGTTCTTAGCAGAGTGTGACACAGTGGAGCAATACATCTGCCAAGAGACAGAGCGGCTGCAGTCTACAAACTTGGCCCTGGCTGAATGAAGTGCAGTGG

AGAGTGGCTGTACTGGCCTGAAGAGCAGCTTTACAGCCCTGCCCTCTCTGGAACAGAAGTCGCCTGTTTCTCCATGGCTGCCAGGGGCAACTAGCCAAAT

GTCAATTTCCCTGCTCCTCCGTCGGTTCTCAATGAAAAAGTCCTGTCTTTGCAACCTGAATTAGACTTGTGTTTTCTCA
Translation
MAKTEEMVQTEEMETPRLSVIVTHS - UNI27093 - SNERYDLLVTPQQGNSEPVVQDLAQLVEEATGVPLPFQKLIFKG GKSLKEMETPLSALGM

QNGCRVMLIGEK - UNI490 - SNPEEEVELKKLKDLEVSAEKIANHLQELNKELSGIQQ - UNI13748 - GFLAKELQAEALCKLDRKVKATIE

QFMKILEEIDTM VLPEQFKDSRLKRKNLVKKVQ VFLAECDTVEQYICQETERLQSTNLALAE
Transcript ENSMUST00000030125
Sequence
GCCACCGCTGCGCTGTGAACAAACGCGGCCTGGCGGGTCGCAGCGCCGCGCGGCGACCGCGAGGCGACCGGGAGCCGCTGGGACCCAGGCTGCGCGCCCC

TCGGCCTGCCCGGGAGCCGCGCCAGTCGGAGTCCCGGGCCGAGCGGGGCTTGCCTCCCTCTCAGCGTTCCTCTGTGCGCAGTGCAGCCAGCGGGCATGAC

CGATCCACCAGGGGCGCCGCCGCCGGCGCCTGCAAGCCGCGGGTGAAGAAGAAAGTCCGGCCCCGCTCTTCTCAGAGCGAGAAGGTAGGGAGCAGCAGCA

GGGAGTTGACTAGAAGTAAGAAAGTGACCCGTAGCAAGAACGTGACCGGGACCCAGGTAGAGGAGGTGACCAAGATCGAGGAGGCGACCCAAACCGAGGA

AGTAACTGTGGCAGAAGAGGTGACCCAGACCGACAACATGGCCAAGACCGAGGAGATGGTCCAGACGGAGGAAATGGAAACACCCAGACTCAGCGTGATC

GTCACCCACA - UNI27093 - GCAATGAGAGGTATGACCTTCTTGTTACCCCACAGCAAGGTAACAGTGAGCCAGTTGTCCAAGACTTGGCTCAGCT

TGTTGAAGAGGCCACAGGAGTTCCACTACCTTTTCAGAAGCTCATATTTAAGG GAAAATCTCTGAAAGAAATGGAAACACCGTTGTCAGCACTTGGAAT

GCAAAATGGTTGCCGAGTCATGTTAATTGGTGAAAAG - UNI490 - AGCAATCCAGAAGAAGAGGTTGAGTTAAAGAAGCTGAAAGATTTGGAGGTA

TCTGCAGAGAAGATAGCTAACCACCTGCAAGAATTGAATAAAGAGCTTTCTGGCATCCAGCAG - UNI13748 - GGTTTTCTGGCTAAGGAATTGCA

AGCGGAGGCTCTCTGCAAACTTGATAGGAAAGTAAAAGCAACAATTGAGCAATTCATGAAGATCTTGGAGGAGATTGACACAATG GTCCTACCAGAACA

ATTTAAAGACAGCAGGCTAAAAAGGAAGAATTTGGTGAAAAAGGTTCAG GTGTTCTTAGCAGAGTGTGACACAGTGGAGCAATACATCTGCCAAGAGAC

AGAGCGGCTGCAGTCTACAAACTTGGCCCTGGCTGAATGAAGTGCAGTGGAGAGTGGCTGTACTGGCCTGAAGAGCAGCTTTACAGCCCTGCCCTCTCTG

GAACAGAAGTCGCCTGTTTCTCCATGGCTGCCAGGGGCAACTAGCCAAATGTCAATTTCCCTGCTCCTCCGTCGGTTCTCAATGAAAAAGTCCTGTCTTT

GCAACCTG
Translation
LAGRSAARRPRGDREPLGPRLRAPRPAREPRQSESRAERGLPPSQRSSVRSAASGHDRSTRGAAAGACKPRVKKKVRPRSSQSEKVGSSSRELTRSKKVT

RSKNVTGTQVEEVTKIEEATQTEEVTVAEEVTQTDNMAKTEEMVQTEEMETPRLSVIVTHS - UNI27093 - SNERYDLLVTPQQGNSEPVVQDLAQ

LVEEATGVPLPFQKLIFKG GKSLKEMETPLSALGMQNGCRVMLIGEK - UNI490 - SNPEEEVELKKLKDLEVSAEKIANHLQELNKELSGIQQ -

 UNI13748 - GFLAKELQAEALCKLDRKVKATIEQFMKILEEIDTM VLPEQFKDSRLKRKNLVKKVQ VFLAECDTVEQYICQETERLQSTNLALAE


For any suggestions or comments, please send an email to unitrap@crg.es