Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028427 (Aqp7)
Chromosomal location
Chr 4: 40932226 - 40995003 (-)
Description
aquaporin 7 Gene [Source:MGI (curated);Acc:Aqp7-001]
RefSeq_dna
NM_007473 
RefSeq_peptide
NP_031499.1 
UniGene
Mm.8728 
MGI
MGI:1314647 
Uniprot/SWISSPROT
O54794 
Uniprot/SPTREMBL
Q5DX24 
Human Ortholog
ENSG00000186466 (AQP7P1)
Omim not available
UniTrap UNI24063
Vector Insertion
Chr 4: 40983171 - 40992312
Public Clones not available
Private Clones OST236172 (lexicon) OST125402 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20913
Vector Insertion
Chr 4: 40982664 - 40983046
Public Clones not available
Private Clones OST348410 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33760
Vector Insertion
Chr 4: 40932225 - 40981493
Public Clones IST10235H4 (tigm) IST14937E1 (tigm) IST14184A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000054945
Sequence
GAGGCAGACTTGAATCTCCTTTCTGTTTGTTAGCTTGGTCTGCTGCTTCAGGTCCACCCACAACTCCACAATGGCCCCCAGGTCTGTGCTGGAGACCATA

CAATCAGTGCTACAGAAGAATATGGTGCGAGAGTTTCTGGCAGAGTTCCTGAGTACCTATGTCATGATG - UNI24063 - GTGTTTGGCCTTGGTTC

CGTGGCTCACATGGTTTTAGGAGAAAACTCTGGCAGCTATCTCGGTGTCAACTTGGGTTTTGGATTCGGAGTGACCATGGGAGTCCATGTAGCAGGCGGC

ATCTCTG - UNI20913 - GGGCCCACATGAATGCCGCAGTGACTTTCACCAATTGTGCACTAGGCCGAATGACCTGGAAGAAGTTCCCTGTATATGT

GCTGGGTCAGTTCCTGGGCTCCTTCTCAGCTGCAGCTACCACCTACTTAATTTTCTATG GTGCCATTAACCACTTTGCAGGCGGAGACCTGTTGGTGAC

AGGTTCCAAGGCCACTGCAAACATTTTTGCCACCTATCTTCCTGAATACATGACACTGTGGCGGGGCTTCCTGGATGAG GCATTCGTGACTGGGATGCT

GCAGCTGTGTCTCTTCGCCATCACCGACAAGAAGAACAGTCCAGCACTTCAAGGGACCGAGCCCCTCGTGATAGGCATCCTTGTTACCGTCCTTGGGGTG

TCGCTAGGCATGAACTCCGGATATGCAATCAACCCATCCCGTGACCTGCCTCCCCGGTTGTTCACTTTCATTGCTGGCTGGGGCAAACAAGTGTTCAG -

 UNI33760 - AGCCGGAAACAACTGGTGGTGGGTGCCGGTGGTGGCACCACTTCTGGGCGCCTACCTAGGTGGTATTGTATACCTGGGTTTAATTCAC

CCCAGCATACCACAGGATCCTCAGAGACTGGAGAATTTTACAGCAAGAGACCAGAAGGTAACTGCATCATACAAGAATGCAGCTTCTGCAAACATAAGTG

GCTCTGTGCCTCTAGAGCACTTCTAAGTAGAGCTTCTCTTTGACCACAACCGTACTGCAATAAAGCACACCACCTATCAGCGGTCCCCCACTCCTTGGGA

TCTCCTGCAGCTGAACTCCCTCCTAGGTTTTTCTGGGAGCTTCTGAGTTATTCCAGCCTGGTACTTGTCGTGGAGAGCAGGCTGGCCTTGAACTTGTGAT

CTTCTTGCCTCTTTCTCCTGAGTGCTGGGGATACAGGCATTTACTACCCTGCTTGGCATATTCCAGGGTGATTCTGGGCTCTTTTCTGAGGACTAGAGCA

TAGGGTCAGAAGACTCCAGCTCTTTCCAGTTCTAGGAGGTGGGGTGTCAAGGGGGAATGTCTACTTTGGGGGCTCAGGGTGAGTGATATAAAGGGCTTTC

GTGCATCAGTATGTGTGTTGGGGGAACAGTGAGAAAAAGACCGGAGGTAGCTGATGGGAGATCAGATTTGGGGGTCTTTGACGGTTTTCTGGATAGGAGT

ACAGGATCTCCTGGCTTCTCCCTTCCTCTAGTTTTGAGCCAGAGAAGGTAAGGCTAAGAGTTTACATCAGAATTCCTCAACTTTTTTTTTTTTTTTTTGT

TAATGACTTCCTCAGTGGCCTTGTAGTTCTCCACCCCTGTTTTTCTTAAAATTATGTAGCCCAGGCTAGCCTTGACTGGAACTCTTATATAACTAAGTTT

AGCCATGAACTCTGGATTGTCTGGCCTCCACCTCCTGAGTTCTGGGATTACAGGTGCGCACCACCATTCCCAGTTTATATGTGGTGCTGGGATCAAACCC

AAGGCCTTGTGTATGCTAGGTAATATCCATAACTAACTTAAATCCCAGCTCCCCAGTTTTTTCTTTTCTTGTCTTTTCTCTTTCTTTCTCTCTTTCTTTC

TTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTCTTTCTTTCCTTCCTTCCTTCCTTCCTTCCTTCCTTCCTTCCTTCCTTTC

TTTTTTTTTTTCTTTTTTTGGTTTTTCAAGACAGGGTTTCTCGGTGTAGCCCTGGCTGTCCTGGAACTCACTTTGTAGACTAGGCTGGCCTCGAACTCAG

AAATCCGCCTGCCTCTGCCTCCCAAGTGCTGGGATTAAAGGCGTGCGCCACCACTGCCCGGCCCAAATTTTTTCTTAATTAAAAATTTTAATACCACA
Translation
MAPRSVLETIQSVLQKNMVREFLAEFLSTYVMM - UNI24063 - VFGLGSVAHMVLGENSGSYLGVNLGFGFGVTMGVHVAGGISG - UNI20913

 - GAHMNAAVTFTNCALGRMTWKKFPVYVLGQFLGSFSAAATTYLIFYG GAINHFAGGDLLVTGSKATANIFATYLPEYMTLWRGFLDE AFVTGMLQ

LCLFAITDKKNSPALQGTEPLVIGILVTVLGVSLGMNSGYAINPSRDLPPRLFTFIAGWGKQVFR - UNI33760 - RAGNNWWWVPVVAPLLGAYLG

GIVYLGLIHPSIPQDPQRLENFTARDQKVTASYKNAASANISGSVPLEHF
Transcript ENSMUST00000030136
Sequence
TACAGTTCAGTTGCAGCTTGAGTCTGCCTCCCTGATAGAGAAACGGAATCAAGACCAGCTGTGAGACGGAGGCTGAAAGACACAGAGCACTTCAGAGA A

CCTACTTCATAAGACCAGCAACTCGACGCCGGGTGAAAATTACCATCTCCGCACTGCACCTCCAGCCTCTCTCGTCTTCCTGTGGGTCTCAGCTCAGACA

GGGGTCCCCTTCTCCTCGGCTCCAGCCAGAAGTCAAGG CTTGGTCTGCTGCTTCAGGTCCACCCACAACTCCACAATGGCCCCCAGGTCTGTGCTGGAG

ACCATACAATCAGTGCTACAGAAGAATATGGTGCGAGAGTTTCTGGCAGAGTTCCTGAGTACCTATGTCATGATG - UNI24063 - GTGTTTGGCCT

TGGTTCCGTGGCTCACATGGTTTTAGGAGAAAACTCTGGCAGCTATCTCGGTGTCAACTTGGGTTTTGGATTCGGAGTGACCATGGGAGTCCATGTAGCA

GGCGGCATCTCTG - UNI20913 - GGGCCCACATGAATGCCGCAGTGACTTTCACCAATTGTGCACTAGGCCGAATGACCTGGAAGAAGTTCCCTGT

ATATGTGCTGGGTCAGTTCCTGGGCTCCTTCTCAGCTGCAGCTACCACCTACTTAATTTTCTATG GTGCCATTAACCACTTTGCAGGCGGAGACCTGTT

GGTGACAGGTTCCAAGGCCACTGCAAACATTTTTGCCACCTATCTTCCTGAATACATGACACTGTGGCGGGGCTTCCTGGATGAG GCATTCGTGACTGG

GATGCTGCAGCTGTGTCTCTTCGCCATCACCGACAAGAAGAACAGTCCAGCACTTCAAGGGACCGAGCCCCTCGTGATAGGCATCCTTGTTACCGTCCTT

GGGGTGTCGCTAGGCATGAACTCCGGATATGCAATCAACCCATCCCGTGACCTGCCTCCCCGGTTGTTCACTTTCATTGCTGGCTGGGGCAAACAAGTGT

TCAG - UNI33760 - AGCCGGAAACAACTGGTGGTGGGTGCCGGTGGTGGCACCACTTCTGGGCGCCTACCTAGGTGGTATTGTATACCTGGGTTTA

ATTCACCCCAGCATACCACAGGATCCTCAGAGACTGGAGAATTTTACAGCAAGAGACCAGAAGGTAACTGCATCATACAAGAATGCAGCTTCTGCAAACA

TAAGTGGCTCTGTGCCTCTAGAGCACTTCTAAGTAGAGCTTCTCTTTGACCACAACCGTACTGCAATAAAGCACACCACCTATCAGCGGTCCCCCACTCC

TTGGGATCTCCTGCAGCTGAACTCCCTCCTAGGTTTTTCTGGGAGCTTCTGAGTTATTCCAGCCTGGTACTTGTCGTGGAGAGCAGGCTGGCCTTGAACT

TGTGATCTTCTTGCCTCTTTCTCCTGAGTGCTGGGGATACAGGCATTTACTACCCTGCTTGGCATATTCCAGGGTGATTCTGGGCTCTTTTCTGAGGACT

AGAGCATAGGGTCAGAAGACTCCAGCTCTTTCCAGTTCTAGGAGGTGGGGTGTCAAGGGGGAATGTCTACTTTGGGGGCTCAGGGTGAGTGATATAAAGG

GCTTTCGTGCATCAGTATGTGTGTTGGGGGAACAGTGAGAAAAAGACCGGAGGTAGCTGATGGGAGATCAGATTTGGGGGTCTTTGACGGTTTTCTGGAT

AGGAGTACAGGATCTCCTGGCTTCTCCCTTCCTCTAGTTTTGAGCCAGAGAAGGTAAGGCTAAGAGTTTACATCAGAATTCCTCAACTTTTTTTTTTTTT

TTTTGTTAATGACTTCCTCAGTGGCCTTGTAGTTCTCCACCCCTGTTTTTCTTAAAATTATGTAGCCCAGGCTAGCCTTGACTGGAACTCTTATATAACT

AAGTTTAGCCATGAACTCTGGATTGTCTGGCCTCCACCTCCTGAGTTCTGGGATTACAGGTGCGCACCACCATTCCCAGTTTATATGTGGTGCTGGGATC

AAACCCAAGGCCTTGTGTATGCTAGGTAATATCCATAACTAACTTAAATCCCAGCTCCCCAGTTTTTTCTTTTCTTGTCTTTTCTCTTTCTTTCTCTCTT

TCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTCTTTCTTTCCTTCCTTCCTTCCTTCCTTCCTTCCTTCCTTCCTT

CCTTTCTTTTTTTTTTTCTTTTTTTGGTTTTT
Translation
  MAPRSVLETIQSVLQKNMVREFLAEFLSTYVMM - UNI24063 - VFGLGSVAHMVLGENSGSYLGVNLGFGFGVTMGVHVAGGISG - UNI209

13 - GAHMNAAVTFTNCALGRMTWKKFPVYVLGQFLGSFSAAATTYLIFYG GAINHFAGGDLLVTGSKATANIFATYLPEYMTLWRGFLDE AFVTGM

LQLCLFAITDKKNSPALQGTEPLVIGILVTVLGVSLGMNSGYAINPSRDLPPRLFTFIAGWGKQVFR - UNI33760 - RAGNNWWWVPVVAPLLGAY

LGGIVYLGLIHPSIPQDPQRLENFTARDQKVTASYKNAASANISGSVPLEHF
Transcript ENSMUST00000116345
Sequence
TACAGTTCAGTTGCAGCTTGAGTCTGCCTCCCTGATAGAGAAACGGAATCAAGACCAGCTGTGAGACGGAGGCTGAAAGACACAGAGCACTTCAGAGA A

CCTACTTCATAAGACCAGCAACTCGACGCCGGGTGAAAATTACCATCTCCGCACTGCACCTCCAGCCTCTCTCGTCTTCCTGTGGGTCTCAGCTCAGACA

GGGGTCCCCTTCTCCTCGGCTCCAGCCAGAAGTCAAGG CTTGGTCTGCTGCTTCAGGTCCACCCACAACTCCACAATGGCCCCCAGGTCTGTGCTGGAG

ACCATACAATCAGTGCTACAGAAGAATATGGTGCGAGAGTTTCTGGCAGAGTTCCTGAGTACCTATGTCATGATG - UNI24063 - GTGTTTGGCCT

TGGTTCCGTGGCTCACATGGTTTTAGGAGAAAACTCTGGCAGCTATCTCGGTGTCAACTTGGGTTTTGGATTCGGAGTGACCATGGGAGTCCATGTAGCA

GGCGGCATCTCTG - UNI20913 - GGGCCCACATGAATGCCGCAGTGACTTTCACCAATTGTGCACTAGGCCGAATGACCTGGAAGAAGTTCCCTGT

ATATGTGCTGGGTCAGTTCCTGGGCTCCTTCTCAGCTGCAGCTACCACCTACTTAATTTTCTATG GTGCCATTAACCACTTTGCAGGCGGAGACCTGTT

GGTGACAGGTTCCAAGGCCACTGCAAACATTTTTGCCACCTATCTTCCTGAATACATGACACTGTGGCGGGGCTTCCTGGATGAG GCATTCGTGACTGG

GATGCTGCAGCTGTGTCTCTTCGCCATCACCGACAAGAAGAACAGTCCAGCACTTCAAGGGACCGAGCCCCTCGTGATAGGCATCCTTGTTACCGTCCTT

GGGGTGTCGCTAGGCATGAACTCCGGATATGCAATCAACCCATCCCGTGACCTGCCTCCCCGGTTGTTCACTTTCATTGCTGGCTGGGGCAAACAAGTGT

TCAG - UNI33760 - AGCCGGAAACAACTGGTGGTGGGTGCCGGTGGTGGCACCACTTCTGGGCGCCTACCTAGGTGGTATTGTATACCTGGGTTTA

ATTCACCCCAGCATACCACAGGATCCTCAGAGACTGGAGAATTTTACAGCAAGAGACCAGAAGGTAACTGCATCATACAAGAATGCAGCTTCTGCAAACA

TAAGTGGCTCTGTGCCTCTAGAGCACTTCTAAGTAGAGCTTCTCTTTGACCACAACCGTACTGCAATAAAGCACACCACCTATCAGCGGTCCCCCACTCC

TTGGGATCTCCTGCAGCTGAACTCCCTCCTAGGTTTTTCTGGGAGCTTCTGAGTTATTCCAGCCTGGTACTTGTCGTGGAGAGCAGGCTGGCCTTGAACT

TGTGATCTTCTTGCCTCTTTCTCCTGAGTGCTGGGGATACAGGCATTTACTACCCTGCTTGGCATATTCCAGGGTGATTCTGGGCTCTTTTCTGAGGACT

AGAGCATAGGGTCAGAAGACTCCAGCTCTTTCCAGTTCTAGGAGGTGGGGTGTCAAGGGGGAATGTCTACTTTGGGGGCTCAGGGTGAGTGATATAAAGG

GCTTTCGTGCATCAGTATGTGTGTTGGGGGAACAGTGAGAAAAAGACCGGAGGTAGCTGATGGGAGATCAGATTTGGGGGTCTTTGACGGTTTTCTGGAT

AGGAGTACAGGATCTCCTGGCTTCTCCCTTCCTCTAGTTTTGAGCCAGAGAAGGTAAGGCTAAGAGTTTACATCAGAATTCCTCAACTTTTTTTTTTTTT

TTTTGTTAATGACTTCCTCAGTGGCCTTGTAGTTCTCCACCCCTGTTTTTCTTAAAATTATGTAGCCCAGGCTAGCCTTGACTGGAACTCTTATATAACT

AAGTTTAGCCATGAACTCTGGATTGTCTGGCCTCCACCTCCTGAGTTCTGGGATTACAGGTGCGCACCACCATTCCCAGTTTATATGTGGTGCTGGGATC

AAACCCAAGGCCTTGTGTATGCTAGGTAATATCCATAACTAACTTAAATCCCAGCTCCCCAGTTTTTTCTTTTCTTGTCTTTTCTCTTTCTTTCTCTCTT

TCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTCTTTCTTTCCTTCCTTCCTTCCTTCCTTCCTTCCTTCCTTCCTT

CCTTTCTTTTTTTTTTTCTTTT - UNI33760 - TTTCTTTTTTTTTTTCTTTTTTTTTTTTTGAGACAGGGT
Translation
  MAPRSVLETIQSVLQKNMVREFLAEFLSTYVMM - UNI24063 - VFGLGSVAHMVLGENSGSYLGVNLGFGFGVTMGVHVAGGISG - UNI209

13 - GAHMNAAVTFTNCALGRMTWKKFPVYVLGQFLGSFSAAATTYLIFYG GAINHFAGGDLLVTGSKATANIFATYLPEYMTLWRGFLDE AFVTGM

LQLCLFAITDKKNSPALQGTEPLVIGILVTVLGVSLGMNSGYAINPSRDLPPRLFTFIAGWGKQVFR - UNI33760 - RAGNNWWWVPVVAPLLGAY

LGGIVYLGLIHPSIPQDPQRLENFTARDQKVTASYKNAASANISGSVPLEHF - UNI33760 - 

For any suggestions or comments, please send an email to unitrap@crg.es